Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. In vivo and in vitro evidence that cross-reactive antibodies to C-terminus of hypervariable region 1 do not neutralize heterologous hepatitis C virus.

    ID: 1313023

    Description: epitope description:ASQKIQLI antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:2Aa, 2Ed, 9Dd, 9Gc, 11Gb, 18Hd, 18Ie

    Publication: 12163260;

  2. In vivo and in vitro evidence that cross-reactive antibodies to C-terminus of hypervariable region 1 do not neutralize heterologous hepatitis C virus.

    ID: 1313028

    Description: epitope description:ASQKIQLI antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:2Aa, 2Ed, 9Dd, 9Gc, 11Gb, 18Hd, 18Ie

    Publication: 12163260;

  3. Reactivity to B cell epitopes within hepatitis C virus core protein and hepatocellular carcinoma.

    ID: 1313070

    Description: epitope description:QKKNKRNTNRRPQDV antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7528637;

  4. Reactivity to B cell epitopes within hepatitis C virus core protein and hepatocellular carcinoma.

    ID: 1313072

    Description: epitope description:GGVYLLPRRGPRLGV antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7528637;

  5. Neutralizing linear epitopes of B19 parvovirus cluster in the VP1 unique and VP1-VP2 junction regions.

    ID: 1313074

    Description: epitope description:MSKKSGKWWESDDKFAKAVY antigen name:Capsid protein VP1 host organism:Oryctolagus cuniculus

    Publication: 7684458;

  6. Neutralizing linear epitopes of B19 parvovirus cluster in the VP1 unique and VP1-VP2 junction regions.

    ID: 1313076

    Description: epitope description:AKAVYQQFVEFYEKVTGTDL antigen name:Capsid protein VP1 host organism:Oryctolagus cuniculus

    Publication: 7684458;

  7. Identification of a variant A-specific neutralizing epitope on glycoprotein B (gB) of human herpesvirus-6 (HHV-6).

    ID: 1313199

    Description: epitope description:N347 antigen name:DNA replication helicase host organism:Mus musculus antibody name:87-y-13

    Publication: 8813034;

  8. Disruption of anthrax toxin binding with the use of human antibodies and competitive inhibitors.

    ID: 1313299

    Description: epitope description:ETTARIIFNGKDLNLVERRIAAVNPSDPLETTKPDMTLKEALKIAFGFNEPNGNLQYQGKDITEFDFNFDQQTSQNIKNQLAELNATNIYTVLDKIKLNAKMNILIRDKRFHYDRNNIAVGADESVVKEA...

    Publication: 10338505;

  9. Immunization with plasmid DNA encoding hepatitis C virus envelope E2 antigenic domains induces antibodies whose immune reactivity is linked to the inj...

    ID: 1313312

    Description: epitope description:IQLINTDGSWHINRTALNCNASHNTGW antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 9261444;

  10. Immunization with plasmid DNA encoding hepatitis C virus envelope E2 antigenic domains induces antibodies whose immune reactivity is linked to the inj...

    ID: 1313313

    Description: epitope description:IQLINTDGSWHINRTALNCNASHNTGW antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 9261444;

  11. Antiaggregating antibody raised against human PrP 106-126 recognizes pathological and normal isoforms of the whole prion protein.

    ID: 1313385

    Description: epitope description:KTNMKHMAGAAAAGAVVGGLG antigen name:Major prion protein host organism:Mus musculus BALB/c antibody name:mAb 2-40

    Publication: 12043842;

  12. Antiaggregating antibody raised against human PrP 106-126 recognizes pathological and normal isoforms of the whole prion protein.

    ID: 1313386

    Description: epitope description:KTNMKHMAGAAAAGAVVGGLG antigen name:Major prion protein host organism:Mus musculus BALB/c antibody name:mAb 2-40

    Publication: 12043842;

  13. Antiaggregating antibody raised against human PrP 106-126 recognizes pathological and normal isoforms of the whole prion protein.

    ID: 1313391

    Description: epitope description:KTNMKHMAGAAAAGAVVGGLG antigen name:Major prion protein host organism:Mus musculus BALB/c antibody name:mAb 2-40

    Publication: 12043842;

  14. Rabies virus glycoprotein as a carrier for anthrax protective antigen.

    ID: 1313398

    Description: epitope description:FHYDRNNIAVGADESVVKEAHREVINSSTEGLLLNIDKDIRKILSGYIVEIEDTEGLKEVINDRYDMLNISSLRQDGKTFIDFKKYNDKLPLYISNPNYKVNVYAVTKENTIINPSENGDTSTNGIKKIL...

    Publication: 16820183;

  15. Characterization of monoclonal antibodies that specifically recognize the palm subdomain of hepatitis C virus nonstructural protein 5B polymerase.

    ID: 1313611

    Description: epitope description:DSTVTENDIRVEESIYQCCDLAPEARQAIKSLTERLY antigen name:Genome polyprotein host organism:Mus musculus antibody name:16A9C

    Publication: 11325472;

  16. Use of a novel hepatitis C virus (HCV) major-epitope chimeric polypeptide for diagnosis of HCV infection.

    ID: 1313617

    Description: epitope description:PGAKQNVQLINTNGSWHLNSTALNCNDSLNTGWLAGLFYH antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10203493;

  17. Use of a novel hepatitis C virus (HCV) major-epitope chimeric polypeptide for diagnosis of HCV infection.

    ID: 1313625

    Description: epitope description:ILRRHVGPGEGAVQWMNRLIAFASRGNHVSPTHYVPESDA antigen name:Genome polyprotein host organism:Mus musculus antibody name:C100c

    Publication: 10203493;

  18. Use of a novel hepatitis C virus (HCV) major-epitope chimeric polypeptide for diagnosis of HCV infection.

    ID: 1313627

    Description: epitope description:SRRFAQALPVWARPDYNPPLVETWKKPDYEPPVVHG antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 10203493;

  19. Use of a novel hepatitis C virus (HCV) major-epitope chimeric polypeptide for diagnosis of HCV infection.

    ID: 1313629

    Description: epitope description:KNKRNTNRRPQDVKFPGGGQIVGGVYLLPRRGPRLGVRATRKTS antigen name:Genome polyprotein host organism:Mus musculus antibody name:C22c

    Publication: 10203493;

  20. Identification and characterization of the neutralization epitope(s) of the hepatitis E virus.

    ID: 1316657

    Description: epitope description:RANDVLWLSLTAAEYDQSTYGSSTGPVYVS antigen name:Capsid protein host organism:Mus musculus

    Publication: 11601892;

  21. Identification and characterization of the neutralization epitope(s) of the hepatitis E virus.

    ID: 1316659

    Description: epitope description:STYGSSTGPVYVSDSVTLVNVATGAQAVAR antigen name:Capsid protein host organism:Mus musculus

    Publication: 11601892;

  22. Identification and characterization of the neutralization epitope(s) of the hepatitis E virus.

    ID: 1316660

    Description: epitope description:PVYVSDSVTLVNVATGAQAVARSLDWTKVT antigen name:Capsid protein host organism:Mus musculus

    Publication: 11601892;

  23. Identification and characterization of the neutralization epitope(s) of the hepatitis E virus.

    ID: 1316665

    Description: epitope description:VLPLRGKLSFWEAGTTKAGYPYNYNTTASD antigen name:Capsid protein host organism:Mus musculus

    Publication: 11601892;

  24. Identification and characterization of the neutralization epitope(s) of the hepatitis E virus.

    ID: 1316675

    Description: epitope description:HTFDDFCPECRPLGLQGCAFQSTVAELQRL antigen name:Capsid protein host organism:Mus musculus

    Publication: 11601892;

  25. Identification and characterization of the neutralization epitope(s) of the hepatitis E virus.

    ID: 1316677

    Description: epitope description:RPLGLQGCAFQSTVAELQRLKMKVGKTREL antigen name:Capsid protein host organism:Mus musculus

    Publication: 11601892;

  26. Evaluation of the latency-associated nuclear antigen (ORF73) of Kaposi's sarcoma-associated herpesvirus by peptide mapping and bacterially expressed r...

    ID: 1316686

    Description: epitope description:RNRSPERCDLGDDLHLQ antigen name:Protein ORF73 host organism:Homo sapiens

    Publication: 10882613;

  27. Evaluation of the latency-associated nuclear antigen (ORF73) of Kaposi's sarcoma-associated herpesvirus by peptide mapping and bacterially expressed r...

    ID: 1316688

    Description: epitope description:DEQEQQEEQEQQEEQEQ antigen name:Protein ORF73 host organism:Homo sapiens

    Publication: 10882613;

  28. Evaluation of the latency-associated nuclear antigen (ORF73) of Kaposi's sarcoma-associated herpesvirus by peptide mapping and bacterially expressed r...

    ID: 1316695

    Description: epitope description:VLRTSPPHRPGVRMRRV antigen name:Protein ORF73 host organism:Homo sapiens

    Publication: 10882613;

  29. Modulation of proteinase-K resistant prion protein by prion peptide immunization.

    ID: 1316719

    Description: epitope description:ENMYRYPNQVYYRPVDQYSN antigen name:Major prion protein host organism:Mus musculus C57BL/6

    Publication: 11477546;

  30. DNA-based selection and screening of peptide ligands.

    ID: 1316746

    Description: epitope description:KTRTHTNAT host organism:Homo sapiens antibody name:affinity-purified C17

    Publication: 9831038;

  31. DNA-based selection and screening of peptide ligands.

    ID: 1316753

    Description: epitope description:KTRRNTNYQ host organism:Homo sapiens antibody name:affinity-purified C17

    Publication: 9831038;

  32. DNA-based selection and screening of peptide ligands.

    ID: 1316754

    Description: epitope description:KTRRNTNYQ host organism:Homo sapiens antibody name:affinity-purified C17

    Publication: 9831038;

  33. Measurement of bacterial cell wall in tissues by solid-phase radioimmunoassay: correlation of distribution and persistence with experimental arthritis...

    ID: 1316907

    Description: epitope description:N-acetyl-D-galactosamine antigen name:polysaccharide host organism:Oryctolagus cuniculus

    Publication: 6754610;

  34. DNA-based selection and screening of peptide ligands.

    ID: 1317352

    Description: epitope description:KTLRNTNRL host organism:Homo sapiens antibody name:affinity-purified C17

    Publication: 9831038;

  35. DNA-based selection and screening of peptide ligands.

    ID: 1317375

    Description: epitope description:YTLPRSSNS host organism:Homo sapiens antibody name:HCV-positive sera

    Publication: 9831038;

  36. DNA-based selection and screening of peptide ligands.

    ID: 1317390

    Description: epitope description:SPTHRINAQ host organism:Homo sapiens antibody name:HCV-positive sera

    Publication: 9831038;

  37. Generation of monoclonal antibodies directed against the immunogenic glycoprotein K8.1 of human herpesvirus 8.

    ID: 1317391

    Description: epitope description:SGQVYQDWLGRMNCSYENMTALE antigen name:Protein K8.1 host organism:Mus musculus BALB/c antibody name:BS 555

    Publication: 11001401;

  38. Generation of monoclonal antibodies directed against the immunogenic glycoprotein K8.1 of human herpesvirus 8.

    ID: 1317392

    Description: epitope description:SGQVYQDWLGRMNCSYENMTALE antigen name:Protein K8.1 host organism:Mus musculus BALB/c antibody name:BS 555

    Publication: 11001401;

  39. DNA-based selection and screening of peptide ligands.

    ID: 1317396

    Description: epitope description:KTKRNTNR antigen name:Genome polyprotein host organism:Homo sapiens antibody name:affinity-purified C17, affinity-purified C65

    Publication: 9831038;

  40. Generation of monoclonal antibodies directed against the immunogenic glycoprotein K8.1 of human herpesvirus 8.

    ID: 1317401

    Description: epitope description:SYENMTALEAVSLNGTRLAAGSPS antigen name:Protein K8.1 host organism:Mus musculus BALB/c antibody name:BS 552, 553, 554, 556, 557, 558...

    Publication: 11001401;

  41. Hepatitis C epitopes from phage-displayed cDNA libraries and improved diagnosis with a chimeric antigen.

    ID: 1317407

    Description: epitope description:EEYVEVTRVGDFHYVTGM antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10596013;

  42. Improved reactivity of hepatitis C virus core protein epitopes in a conformational antigen-presenting system.

    ID: 1317427

    Description: epitope description:MSTNPKPQRKTKRNTNRRPQ antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 9067642;

  43. Improved reactivity of hepatitis C virus core protein epitopes in a conformational antigen-presenting system.

    ID: 1317429

    Description: epitope description:DVKFPGGGQIVGGVYLLPRR antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 9067642;

  44. High prevalence of hypervariable region 1-specific and -cross-reactive CD4(+) T cells in HCV-infected individuals responsive to IFN-alpha treatment.

    ID: 1317460

    Description: epitope description:ETHTSGGSVARAAFGLTSIFSPGAKQN antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10753710;

  45. Antigenic features of prion proteins of sheep and of other mammalian species.

    ID: 1317532

    Description: epitope description:KHVAGAAAAGAVVGGLGGY antigen name:Major prion protein host organism:Oryctolagus cuniculus Chinchilla antibody name:Ra anti 113-131

    Publication: 9328590;

  46. Antigenic features of prion proteins of sheep and of other mammalian species.

    ID: 1317533

    Description: epitope description:GNDYEDRYYRENMYRYPNQ antigen name:Major prion protein host organism:Oryctolagus cuniculus Chinchilla antibody name:Ra anti 145-163

    Publication: 9328590;

  47. Antigenic features of prion proteins of sheep and of other mammalian species.

    ID: 1317539

    Description: epitope description:TVTTTTKGENFTETDIKI antigen name:Major prion protein host organism:Oryctolagus cuniculus Chinchilla antibody name:Ra anti 191-208

    Publication: 9328590;

  48. Antigenic epitope mapping of the M24 protein of Streptococcus pyogenes: implications for serodiagnosis of rheumatic fever.

    ID: 1317548

    Description: epitope description:NTLKLKNSDLSFNNKA antigen name:UniProt:A2RGM0 host organism:Homo sapiens Australian Aboriginal

    Publication: 9116645;

  49. Antigenic epitope mapping of the M24 protein of Streptococcus pyogenes: implications for serodiagnosis of rheumatic fever.

    ID: 1317556

    Description: epitope description:IQELEARKADLEKALE antigen name:UniProt:A2RGM0 host organism:Homo sapiens Australian Aboriginal

    Publication: 9116645;

  50. Antigenic epitope mapping of the M24 protein of Streptococcus pyogenes: implications for serodiagnosis of rheumatic fever.

    ID: 1317558

    Description: epitope description:KALEGAMNFSTADSAK antigen name:UniProt:A2RGM0 host organism:Homo sapiens Australian Aboriginal

    Publication: 9116645;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston