Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 100 of 1,510,353 results for " "

  1. Structure, antigenic determinants of some clinically important insect allergens: chironomid hemoglobins.

    ID: 1410195

    Description: epitope description:IIGDLPNIDGDVTTFVASHTPR antigen name:Globin CTT-IV host organism:Homo sapiens antibody name:patient sera

    Publication: 2425431;

  2. Enhanced immunogenicity of modified hepatitis B virus core particle fused with multiepitopes of foot-and-mouth disease virus.

    ID: 1410199

    Description: epitope description:VPNLRGDLQVLAQKVARTLP antigen name:Polyprotein host organism:Mus musculus BALB/c

    Publication: 17386022;

  3. Epitopes of herpes simplex virus type 1 glycoprotein B that bind type-common neutralizing antibodies elicit type-specific antibody-dependent cellular ...

    ID: 1410200

    Description: epitope description:APSSPGTPGVAAATQAANGG antigen name:Envelope glycoprotein B host organism:Mus musculus BALB/c antibody name:H1817

    Publication: 1380051;

  4. A novel approach for investigation of specific and cross-reactive IgE epitopes on Bet v 1 and homologous food allergens in individual patients.

    ID: 1388749

    Description: epitope description:YKIGDNW host organism:Homo sapiens antibody name:patient #4 serum IgE

    Publication: 16199263;

  5. A novel approach for investigation of specific and cross-reactive IgE epitopes on Bet v 1 and homologous food allergens in individual patients.

    ID: 1388753

    Description: epitope description:KSDNNVT host organism:Homo sapiens antibody name:patient #4 serum IgE

    Publication: 16199263;

  6. A novel approach for investigation of specific and cross-reactive IgE epitopes on Bet v 1 and homologous food allergens in individual patients.

    ID: 1388754

    Description: epitope description:KSDNNVT host organism:Homo sapiens antibody name:patient #4 serum IgE

    Publication: 16199263;

  7. A novel approach for investigation of specific and cross-reactive IgE epitopes on Bet v 1 and homologous food allergens in individual patients.

    ID: 1388755

    Description: epitope description:SKTDNLT host organism:Homo sapiens antibody name:patient #4 serum IgE

    Publication: 16199263;

  8. A novel approach for investigation of specific and cross-reactive IgE epitopes on Bet v 1 and homologous food allergens in individual patients.

    ID: 1388759

    Description: epitope description:YLMEVQK host organism:Homo sapiens antibody name:patient #5 serum IgE

    Publication: 16199263;

  9. A novel approach for investigation of specific and cross-reactive IgE epitopes on Bet v 1 and homologous food allergens in individual patients.

    ID: 1388761

    Description: epitope description:YLMEVQK host organism:Homo sapiens antibody name:patient #5 serum IgE

    Publication: 16199263;

  10. A novel approach for investigation of specific and cross-reactive IgE epitopes on Bet v 1 and homologous food allergens in individual patients.

    ID: 1388764

    Description: epitope description:YEMDAPK host organism:Homo sapiens antibody name:patient #5 serum IgE

    Publication: 16199263;

  11. A novel approach for investigation of specific and cross-reactive IgE epitopes on Bet v 1 and homologous food allergens in individual patients.

    ID: 1388766

    Description: epitope description:ERHLTFT host organism:Homo sapiens antibody name:patient #5 serum IgE

    Publication: 16199263;

  12. Dominant epitopes of the C6 diagnostic peptide of Borrelia burgdorferi are largely inaccessible to antibody on the parent VlsE molecule.

    ID: 1388773

    Description: epitope description:GDSEAASKAAGAVSAVSGEQILSAIV antigen name:Outer surface protein VlsE1 host organism:Homo sapiens antibody name:Human sera

    Publication: 17567769;

  13. Dominant epitopes of the C6 diagnostic peptide of Borrelia burgdorferi are largely inaccessible to antibody on the parent VlsE molecule.

    ID: 1388779

    Description: epitope description:GIAKGIKEIVEAA antigen name:Outer surface protein VlsE1 host organism:Homo sapiens antibody name:Human sera

    Publication: 17567769;

  14. Dominant epitopes of the C6 diagnostic peptide of Borrelia burgdorferi are largely inaccessible to antibody on the parent VlsE molecule.

    ID: 1388788

    Description: epitope description:MKKDDQIAAAIALRGMAKDGKFAVK antigen name:Outer surface protein VlsE1 host organism:Homo sapiens antibody name:Human sera

    Publication: 17567769;

  15. Mapping of an allergenically important determinant of grass group I allergens.

    ID: 1388791

    Description: epitope description:STFYGKPTGAGPK antigen name:Group I allergen FeS e I, pollen host organism:Mus musculus BALB/c antibody name:mAb 24.64

    Publication: 9314345;

  16. Mapping of an allergenically important determinant of grass group I allergens.

    ID: 1388792

    Description: epitope description:STFYGKPTGAGPK antigen name:Group I allergen FeS e I, pollen host organism:Mus musculus BALB/c antibody name:mAb 24.64

    Publication: 9314345;

  17. Expression of BARF1 gene encoded by Epstein-Barr virus in nasopharyngeal carcinoma biopsies.

    ID: 1388793

    Description: epitope description:NGGVMKEKD antigen name:Secreted protein BARF1 host organism:Oryctolagus cuniculus

    Publication: 11034107;

  18. Expression of BARF1 gene encoded by Epstein-Barr virus in nasopharyngeal carcinoma biopsies.

    ID: 1388795

    Description: epitope description:GKNDKEE antigen name:Secreted protein BARF1 host organism:Oryctolagus cuniculus

    Publication: 11034107;

  19. Characterization of hepatitis C virus E2 glycoprotein interaction with a putative cellular receptor, CD81.

    ID: 1390531

    Description: epitope description:LDERPYCWHYPPRP antigen name:Genome polyprotein host organism:Rattus norvegicus antibody name:6/41a

    Publication: 10400713;

  20. The IgE-binding epitopes of rPar j 2, a major allergen of Parietaria judaica pollen, are heterogeneously recognized among allergic subjects.

    ID: 1397346

    Description: epitope description:SGTKKLSEEVKTTEQKREACKCIVR antigen name:Par j 2 host organism:Homo sapiens

    Publication: 10753015;

  21. Identification of HCV core mimotopes: improved methods for the selection and use of disease-related phage-displayed peptides.

    ID: 1397348

    Description: epitope description:YQPGAGWLA host organism:Homo sapiens

    Publication: 9224929;

  22. The IgE-binding epitopes of rPar j 2, a major allergen of Parietaria judaica pollen, are heterogeneously recognized among allergic subjects.

    ID: 1397351

    Description: epitope description:ACKCIVRATKGISGIKNELVAEVPKKC antigen name:Par j 2 host organism:Homo sapiens

    Publication: 10753015;

  23. Identification of HCV core mimotopes: improved methods for the selection and use of disease-related phage-displayed peptides.

    ID: 1397353

    Description: epitope description:LPWGVAARR host organism:Homo sapiens

    Publication: 9224929;

  24. Identification of HCV core mimotopes: improved methods for the selection and use of disease-related phage-displayed peptides.

    ID: 1397354

    Description: epitope description:LPAHGPSLS host organism:Homo sapiens

    Publication: 9224929;

  25. Hepatitis C virus glycoproteins mediate pH-dependent cell entry of pseudotyped retroviral particles.

    ID: 1397563

    Description: epitope description:SLNTGWLAGLFY antigen name:Genome polyprotein host organism:Rattus norvegicus antibody name:2/69a, 1/39

    Publication: 12761383;

  26. Hepatitis C virus epitope-specific neutralizing antibodies in Igs prepared from human plasma.

    ID: 1397700

    Description: epitope description:WHINSTALNCNESL antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 17494735;

  27. Hepatitis C virus epitope-specific neutralizing antibodies in Igs prepared from human plasma.

    ID: 1397701

    Description: epitope description:QLINTNGSWHINSTA antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 17494735;

  28. Identification of an immunodominant IgE epitope of the Parietaria judaica major allergen.

    ID: 1397743

    Description: epitope description:K21, K23, E24, K27 antigen name:Par j 1 host organism:Homo sapiens

    Publication: 9510179;

  29. A self-adjuvanting multiepitope immunogen that induces a broadly cross-reactive antibody to hepatitis C virus.

    ID: 1402825

    Description: epitope description:TTTTGGQVGH antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 17393515;

  30. Epitope mapping of herpes simplex virus type 2 gH/gL defines distinct antigenic sites, including some associated with biological function.

    ID: 1402930

    Description: epitope description:LNLTTASVPMLRWYAERFCF antigen name:Envelope glycoprotein H host organism:Mus musculus antibody name:CHL25

    Publication: 16501070;

  31. Epitope mapping of herpes simplex virus type 2 gH/gL defines distinct antigenic sites, including some associated with biological function.

    ID: 1402935

    Description: epitope description:LSHNPGASALL antigen name:Envelope glycoprotein H host organism:Mus musculus antibody name:CHL35; CHL36

    Publication: 16501070;

  32. Epitope mapping of herpes simplex virus type 2 gH/gL defines distinct antigenic sites, including some associated with biological function.

    ID: 1402940

    Description: epitope description:THTPLPRGIGY antigen name:Envelope glycoprotein H host organism:Mus musculus antibody name:CHL29

    Publication: 16501070;

  33. Epitope mapping of herpes simplex virus type 2 gH/gL defines distinct antigenic sites, including some associated with biological function.

    ID: 1402943

    Description: epitope description:DDEASSQSKPLATQPPVLALSNAPPRRVSPTRGRRRHT antigen name:Envelope glycoprotein L host organism:Mus musculus antibody name:CHL26

    Publication: 16501070;

  34. Epitope mapping of herpes simplex virus type 2 gH/gL defines distinct antigenic sites, including some associated with biological function.

    ID: 1402950

    Description: epitope description:YAQYMSRAYAEFLGEDPGSG antigen name:Envelope glycoprotein H host organism:Mus musculus antibody name:CHL38

    Publication: 16501070;

  35. Epitope mapping of herpes simplex virus type 2 gH/gL defines distinct antigenic sites, including some associated with biological function.

    ID: 1402962

    Description: epitope description:R146, A147, G148, C149, V150, N151, F152, D153, Y154, S155, R156, T157, R158, R159, C160, V161, G162, R163, R164, D165, P205, P206...

    Publication: 16501070;

  36. Epitope mapping of herpes simplex virus type 2 gH/gL defines distinct antigenic sites, including some associated with biological function.

    ID: 1402964

    Description: epitope description:L145, S146, H147, N148, P149, G150, A151, S152, A153, L154, L155, T676, H677, T678, P679, L680, P681, R682, G683, I684, G685, Y686...

    Publication: 16501070;

  37. Epitope mapping of herpes simplex virus type 2 gH/gL defines distinct antigenic sites, including some associated with biological function.

    ID: 1402968

    Description: epitope description:L145, S146, H147, N148, P149, G150, A151, S152, A153, L154, L155, T676, H677, T678, P679, L680, P681, R682, G683, I684, G685, Y686...

    Publication: 16501070;

  38. Epitope mapping of herpes simplex virus type 2 gH/gL defines distinct antigenic sites, including some associated with biological function.

    ID: 1402971

    Description: epitope description:HDTYWTEQIEPWFLHGLGLAR antigen name:Envelope glycoprotein H host organism:Mus musculus antibody name:CHL17; CHL32

    Publication: 16501070;

  39. Selection of peptides recognized by human antibodies against the surface of Plasmodium falciparum-infected erythrocytes.

    ID: 1402978

    Description: epitope description:CTPATLLLC host organism:Homo sapiens

    Publication: 15700752;

  40. Selection of peptides recognized by human antibodies against the surface of Plasmodium falciparum-infected erythrocytes.

    ID: 1402979

    Description: epitope description:CMRLGSSIC host organism:Homo sapiens

    Publication: 15700752;

  41. Selection of peptides recognized by human antibodies against the surface of Plasmodium falciparum-infected erythrocytes.

    ID: 1402988

    Description: epitope description:CVLESHYEC host organism:Homo sapiens

    Publication: 15700752;

  42. Using monoclonal antibodies to characterize a sequential epitope on the group I allergen of Bermuda grass pollen.

    ID: 1403127

    Description: epitope description:DVDKPPFDGMTACGNEPIF antigen name:Cyn d 1 host organism:Mus musculus antibody name:MoAb 18-53

    Publication: 9363907;

  43. Molecular and structural analysis of a continuous birch profilin epitope defined by a monoclonal antibody.

    ID: 1403235

    Description: epitope description:PQFKPQ antigen name:Bet v 2 host organism:Mus musculus BALB/c antibody name:mAb 4A6

    Publication: 8939935;

  44. Molecular and structural analysis of a continuous birch profilin epitope defined by a monoclonal antibody.

    ID: 1403244

    Description: epitope description:PQFKPQ antigen name:Bet v 2 host organism:Mus musculus BALB/c antibody name:mAb 4A6

    Publication: 8939935;

  45. Identification of Hendra virus G glycoprotein residues that are critical for receptor binding.

    ID: 1403268

    Description: epitope description:K443, K465 antigen name:Glycoprotein G host organism:Mus musculus BALB/c antibody name:H2.1

    Publication: 17376907;

  46. IgE binding capacity of synthetic and recombinant peptides of the major storage mite (Lepidoglyphus destructor) allergen, Lep d 2.

    ID: 1403273

    Description: epitope description:GKMTFKDCGHGEVTE antigen name:Lep d 2 host organism:Homo sapiens

    Publication: 9831803;

  47. IgE binding capacity of synthetic and recombinant peptides of the major storage mite (Lepidoglyphus destructor) allergen, Lep d 2.

    ID: 1403276

    Description: epitope description:GKMTFKDCGHGEVTE antigen name:Lep d 2 host organism:Oryctolagus cuniculus

    Publication: 9831803;

  48. IgE binding capacity of synthetic and recombinant peptides of the major storage mite (Lepidoglyphus destructor) allergen, Lep d 2.

    ID: 1403279

    Description: epitope description:GEVTELDITGCSGDT antigen name:Lep d 2 host organism:Homo sapiens

    Publication: 9831803;

  49. Structural basis of neutralization by a human anti-severe acute respiratory syndrome spike protein antibody, 80R.

    ID: 1403284

    Description: epitope description:R426, S432, T433, Y436, N437, K439, Y440, Y442, P469, P470, A471, L472, N473, C474, Y475, W476, L478, N479, D480, Y481, G482, Y484...

    Publication: 16954221;

  50. IgE binding capacity of synthetic and recombinant peptides of the major storage mite (Lepidoglyphus destructor) allergen, Lep d 2.

    ID: 1403286

    Description: epitope description:GEKMTLEAKFAANQD antigen name:Lep d 2 host organism:Oryctolagus cuniculus

    Publication: 9831803;

  51. IgE binding capacity of synthetic and recombinant peptides of the major storage mite (Lepidoglyphus destructor) allergen, Lep d 2.

    ID: 1403287

    Description: epitope description:AANQDTAKVTIKVLA antigen name:Lep d 2 host organism:Oryctolagus cuniculus

    Publication: 9831803;

  52. Identification and expression of an allergen Asp f 13 from Aspergillus fumigatus and epitope mapping using human IgE antibodies and rabbit polyclonal ...

    ID: 1403324

    Description: epitope description:GLENLSGPAAVTARIKELATNGVVTNVKGSPNKLAYNGNA antigen name:Asp f 13 host organism:Homo sapiens antibody name:patient sera

    Publication: 10677362;

  53. IgE binding capacity of synthetic and recombinant peptides of the major storage mite (Lepidoglyphus destructor) allergen, Lep d 2.

    ID: 1403327

    Description: epitope description:GCKFIKCPVKKGEAL antigen name:Lep d 2 host organism:Oryctolagus cuniculus

    Publication: 9831803;

  54. IgE binding capacity of synthetic and recombinant peptides of the major storage mite (Lepidoglyphus destructor) allergen, Lep d 2.

    ID: 1403335

    Description: epitope description:GTIPAITPKVKADVT antigen name:Lep d 2 host organism:Oryctolagus cuniculus

    Publication: 9831803;

  55. IgE binding capacity of synthetic and recombinant peptides of the major storage mite (Lepidoglyphus destructor) allergen, Lep d 2.

    ID: 1403339

    Description: epitope description:KADVTAELIGDHGVM antigen name:Lep d 2 host organism:Oryctolagus cuniculus

    Publication: 9831803;

  56. Identification and expression of an allergen Asp f 13 from Aspergillus fumigatus and epitope mapping using human IgE antibodies and rabbit polyclonal ...

    ID: 1403342

    Description: epitope description:ASNTSPASAPNALTVAAINKSNARASFSNYGSVVD antigen name:Asp f 13 host organism:Homo sapiens antibody name:patient sera

    Publication: 10677362;

  57. Identification and expression of an allergen Asp f 13 from Aspergillus fumigatus and epitope mapping using human IgE antibodies and rabbit polyclonal ...

    ID: 1403345

    Description: epitope description:ALTTQKGAPWGLGSISHKGQASTDYIYD antigen name:Asp f 13 host organism:Homo sapiens antibody name:patient sera

    Publication: 10677362;

  58. IgE binding capacity of synthetic and recombinant peptides of the major storage mite (Lepidoglyphus destructor) allergen, Lep d 2.

    ID: 1403357

    Description: epitope description:GEVTELDISGCSGDT antigen name:Lep d 2 host organism:Oryctolagus cuniculus

    Publication: 9831803;

  59. Different crystal packing in Fab-protein L semi-disordered peptide complex.

    ID: 1403365

    Description: epitope description:STNPKPQRKTKRNTNRRPQDVKFPGGGQIVGGVYLLPRRGPRLG antigen name:Genome polyprotein host organism:Mus musculus antibody name:19D9D6

    Publication: 15930632;

  60. Analyses of the antigenicity of influenza haemagglutinin at the pH optimum for virus-mediated membrane fusion.

    ID: 1403372

    Description: epitope description:D63 antigen name:Hemagglutinin host organism:Mus musculus BALB/c antibody name:HC45

    Publication: 6192202;

  61. Analyses of the antigenicity of influenza haemagglutinin at the pH optimum for virus-mediated membrane fusion.

    ID: 1403379

    Description: epitope description:S157 antigen name:Hemagglutinin host organism:Mus musculus BALB/c antibody name:HC19

    Publication: 6192202;

  62. IgE binding capacity of synthetic and recombinant peptides of the major storage mite (Lepidoglyphus destructor) allergen, Lep d 2.

    ID: 1403449

    Description: epitope description:GCKVLKCPIKKGEAL antigen name:Lep d 2 host organism:Homo sapiens

    Publication: 9831803;

  63. IgE binding capacity of synthetic and recombinant peptides of the major storage mite (Lepidoglyphus destructor) allergen, Lep d 2.

    ID: 1403454

    Description: epitope description:MTIPAITPKIKADVT antigen name:Lep d 2 host organism:Homo sapiens

    Publication: 9831803;

  64. IgE binding capacity of synthetic and recombinant peptides of the major storage mite (Lepidoglyphus destructor) allergen, Lep d 2.

    ID: 1403455

    Description: epitope description:KADVTAELVGDHGVM antigen name:Lep d 2 host organism:Oryctolagus cuniculus

    Publication: 9831803;

  65. Emerging principles for the design of promiscuous HLA-DR-restricted peptides: an example from the major bee venom allergen.

    ID: 1403465

    Description: epitope description:TISSYFVGKMYFNLIDTK antigen name:Api m 1 host organism:Homo sapiens antibody name:patient plasma IgE

    Publication: 12516563;

  66. Binding characteristics determine the neutralizing potential of antibody fragments specific for antigenic domain 2 on glycoprotein B of human cytomega...

    ID: 1403752

    Description: epitope description:ANETIYNTTLKYGDV antigen name:Envelope glycoprotein B host organism:Homo sapiens antibody name:AE11F

    Publication: 12504553;

  67. Binding characteristics determine the neutralizing potential of antibody fragments specific for antigenic domain 2 on glycoprotein B of human cytomega...

    ID: 1403754

    Description: epitope description:ANETIYNTTLKYGDV antigen name:Envelope glycoprotein B host organism:Homo sapiens antibody name:AE11F

    Publication: 12504553;

  68. Modulation of the allergic immune response in BALB/c mice by subcutaneous injection of high doses of the dominant T cell epitope from the major birch ...

    ID: 1404101

    Description: epitope description:MGETLLRAVESYLL antigen name:Bet v 1 host organism:Mus musculus BALB/c antibody name:anti-Bet v 1

    Publication: 9067529;

  69. Measurement of peptide-specific IgE as an additional tool in identifying patients with clinical reactivity to peanuts.

    ID: 1404107

    Description: epitope description:DRRCQSQLER antigen name:Ara h 2 host organism:Homo sapiens

    Publication: 12847500;

  70. Identification of new epitopes recognized by human monoclonal antibodies with neutralizing and antibody-dependent cellular cytotoxicity activities spe...

    ID: 1383011

    Description: epitope description:PPTAPPLLPHSNL antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens antibody name:KE36-11

    Publication: 1378869;

  71. Identification of new epitopes recognized by human monoclonal antibodies with neutralizing and antibody-dependent cellular cytotoxicity activities spe...

    ID: 1383016

    Description: epitope description:PPTAPPLLPHSNL antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens antibody name:KE36-7

    Publication: 1378869;

  72. An epidemiological study of humoral and cell-mediated immune response to the Plasmodium falciparum antigen PF155/RESA in adult Liberians.

    ID: 1383113

    Description: epitope description:DDEHVEEPTVADDEHVEEPTVA antigen name:DNAJ protein, putative host organism:Homo sapiens

    Publication: 2679167;

  73. An epidemiological study of humoral and cell-mediated immune response to the Plasmodium falciparum antigen PF155/RESA in adult Liberians.

    ID: 1383114

    Description: epitope description:EENVEHDA antigen name:DNAJ protein, putative host organism:Homo sapiens

    Publication: 2679167;

  74. An epidemiological study of humoral and cell-mediated immune response to the Plasmodium falciparum antigen PF155/RESA in adult Liberians.

    ID: 1383151

    Description: epitope description:EENVEENV antigen name:DNAJ protein, putative host organism:Homo sapiens

    Publication: 2679167;

  75. Modified-live infectious bovine rhinotracheitis virus vaccine expressing monomer and dimer forms of foot-and-mouth disease capsid protein epitopes on ...

    ID: 1383494

    Description: epitope description:RHKQKIVAPVKQTL antigen name:Polyprotein host organism:Cavia porcellus antibody name:Guinea pig sera

    Publication: 1718244;

  76. Epitope mapping of human herpesvirus-7 gp65 using monoclonal antibodies.

    ID: 1383496

    Description: epitope description:CCPDKNKS antigen name:Spliced glycoprotein host organism:Mus musculus BALB/cByJ antibody name:19F8, 18D6

    Publication: 11699957;

  77. Epitope mapping of human herpesvirus-7 gp65 using monoclonal antibodies.

    ID: 1383498

    Description: epitope description:CCPDKNKS antigen name:Spliced glycoprotein host organism:Mus musculus BALB/cByJ antibody name:19F8, 18D6

    Publication: 11699957;

  78. Modified-live infectious bovine rhinotracheitis virus vaccine expressing monomer and dimer forms of foot-and-mouth disease capsid protein epitopes on ...

    ID: 1383504

    Description: epitope description:RHKQKIVAPVKQTL antigen name:Polyprotein host organism:Bos taurus antibody name:Bovine sera

    Publication: 1718244;

  79. Identification of polyclonal serum specificities with phage-display libraries.

    ID: 1383529

    Description: epitope description:STGPCR antigen name:Large envelope protein host organism:Pan troglodytes antibody name:Chimpanzee sera

    Publication: 8783147;

  80. The amino-terminal residue of glycoprotein B is critical for neutralization of bovine herpesvirus 1.

    ID: 1383571

    Description: epitope description:R68 antigen name:envelope glycoprotein B host organism:Mus musculus BALB/c antibody name:185/2, 9a, 41c, 11be

    Publication: 16153736;

  81. Overcoming class II-linked non-responsiveness to hepatitis B vaccine.

    ID: 1383677

    Description: epitope description:LDSWWTSLNFLGGS antigen name:Large envelope protein host organism:Mus musculus SJL antibody name:Mouse sera

    Publication: 7526566;

  82. Overcoming class II-linked non-responsiveness to hepatitis B vaccine.

    ID: 1383687

    Description: epitope description:FLFILLLCLIFLLV antigen name:Large envelope protein host organism:Mus musculus SJL antibody name:Mouse sera

    Publication: 7526566;

  83. Overcoming class II-linked non-responsiveness to hepatitis B vaccine.

    ID: 1383698

    Description: epitope description:PSCCCTKPTDGNCT antigen name:Large envelope protein host organism:Mus musculus SJL antibody name:Mouse sera

    Publication: 7526566;

  84. Overcoming class II-linked non-responsiveness to hepatitis B vaccine.

    ID: 1383702

    Description: epitope description:PSSWAFAKYLWEWA antigen name:Large envelope protein host organism:Mus musculus SJL antibody name:Mouse sera

    Publication: 7526566;

  85. Overcoming class II-linked non-responsiveness to hepatitis B vaccine.

    ID: 1383704

    Description: epitope description:WEWASVRFSWLSLL antigen name:Large envelope protein host organism:Mus musculus SJL antibody name:Mouse sera

    Publication: 7526566;

  86. Overcoming class II-linked non-responsiveness to hepatitis B vaccine.

    ID: 1383709

    Description: epitope description:LSPTVWLSAIWMMW antigen name:Large envelope protein host organism:Mus musculus SJL antibody name:Mouse sera

    Publication: 7526566;

  87. Overcoming class II-linked non-responsiveness to hepatitis B vaccine.

    ID: 1383714

    Description: epitope description:VSPFIPLLPIFFCL antigen name:Large envelope protein host organism:Mus musculus SJL antibody name:Mouse sera

    Publication: 7526566;

  88. Overcoming class II-linked non-responsiveness to hepatitis B vaccine.

    ID: 1383715

    Description: epitope description:IPLLPIFFCLWVYI antigen name:Large envelope protein host organism:Mus musculus SJL antibody name:Mouse sera

    Publication: 7526566;

  89. Overcoming class II-linked non-responsiveness to hepatitis B vaccine.

    ID: 1383717

    Description: epitope description:FISEAIIHVLHSR antigen name:Physeter catodon (sperm whale) protein host organism:Mus musculus SJL antibody name:Mouse sera

    Publication: 7526566;

  90. Neutralising human recombinant antibodies to human cytomegalovirus glycoproteins gB and gH.

    ID: 1383727

    Description: epitope description:AASEALDPHAFHLLLNTYGR antigen name:Envelope glycoprotein H host organism:Homo sapiens antibody name:human sera

    Publication: 12423777;

  91. Delineation of contiguous determinants essential for biological functions of the pre-S sequence of the hepatitis B virus envelope protein: its antigen...

    ID: 1383758

    Description: epitope description:MQWNSTAFHQTLQDPRVRGLYLPAGGSSSGTVNP antigen name:Large envelope protein host organism:Mus musculus antibody name:F376

    Publication: 2462893;

  92. Delineation of contiguous determinants essential for biological functions of the pre-S sequence of the hepatitis B virus envelope protein: its antigen...

    ID: 1383762

    Description: epitope description:MQWNSTAFHQTLQDPRVRGLYLPAGGSSSGTVNP antigen name:Large envelope protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2462893;

  93. Delineation of contiguous determinants essential for biological functions of the pre-S sequence of the hepatitis B virus envelope protein: its antigen...

    ID: 1383885

    Description: epitope description:MQWNSTAFHQTLQDP antigen name:Large envelope protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2462893;

  94. Characterization and sequence analyses of antibody-selected antigenic variants of herpes simplex virus show a conformationally complex epitope on glyc...

    ID: 1384067

    Description: epitope description:D168 antigen name:Envelope glycoprotein H host organism:Mus musculus antibody name:LP11

    Publication: 1707982;

  95. RIVETS: the recombinant immunoglobulin and viral epitope tag system.

    ID: 1384069

    Description: epitope description:ETIYNTTLKY antigen name:Envelope glycoprotein B host organism:Homo sapiens antibody name:8F9

    Publication: 16919678;

  96. Identification of polyclonal serum specificities with phage-display libraries.

    ID: 1384072

    Description: epitope description:TRVPRR host organism:Pan troglodytes antibody name:Chimpanzee sera

    Publication: 8783147;

  97. Production of hybrid phage displaying secreted aspartyl proteinase epitope of Candida albicans and its application for the diagnosis of disseminated c...

    ID: 1384172

    Description: epitope description:VKYTS antigen name:Candidapepsin-2 host organism:Homo sapiens

    Publication: 17472610;

  98. Delineation of contiguous determinants essential for biological functions of the pre-S sequence of the hepatitis B virus envelope protein: its antigen...

    ID: 1384178

    Description: epitope description:PRVRGLYLPAGG antigen name:Large envelope protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2462893;

  99. Delineation of contiguous determinants essential for biological functions of the pre-S sequence of the hepatitis B virus envelope protein: its antigen...

    ID: 1384179

    Description: epitope description:PRVRGLYLPAGG antigen name:Large envelope protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2462893;

  100. Delineation of contiguous determinants essential for biological functions of the pre-S sequence of the hepatitis B virus envelope protein: its antigen...

    ID: 1384181

    Description: epitope description:QDPRVR antigen name:Large envelope protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2462893;
Displaying 100 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston