Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 100 of 1,510,353 results for " "

  1. Clinical and serological associations of autoantibodies to GW bodies and a novel cytoplasmic autoantigen GW182.

    ID: 1771571

    Description: epitope description:KGGGVWESGAANSQS antigen name:Trinucleotide repeat-containing gene 6A protein host organism:Homo sapiens

    Publication: 14598044;

  2. B-cell epitope spreading is a critical step for the switch from C-protein-induced myocarditis to dilated cardiomyopathy.

    ID: 1768495

    Description: epitope description:AEEDVWEILRQAPPSEYERIAFQYGVTDLRGM antigen name:Myosin-binding protein C, cardiac-type host organism:Rattus norvegicus Lewis

    Publication: 17200181;

  3. Characterization of a factor VIII immunogenic site using factor VIII synthetic peptide 1687-1695 and rabbit anti-peptide antibodies.

    ID: 1768511

    Description: epitope description:SPRSFQKKT antigen name:Coagulation factor VIII host organism:Oryctolagus cuniculus

    Publication: 1378653;

  4. B-cell epitope spreading is a critical step for the switch from C-protein-induced myocarditis to dilated cardiomyopathy.

    ID: 1768532

    Description: epitope description:SFVPEGFACNLSAKLHFMEVKIDFVPRQEPPKI antigen name:Myosin-binding protein C, cardiac-type host organism:Rattus norvegicus Lewis

    Publication: 17200181;

  5. Generation and characterization of peptide-specific antibodies that inhibit von Willebrand factor binding to glycoprotein IIb-IIIa without interacting...

    ID: 1768574

    Description: epitope description:EVVTGSPRGDSQSS antigen name:von Willebrand factor host organism:Oryctolagus cuniculus New Zealand White antibody name:152B

    Publication: 2453507;

  6. Shigella flexneri O-antigen epitopes: chemical and immunochemical analyses reveal that epitopes of type III and group 6 antigens are identical.

    ID: 1768615

    Description: epitope description:2-O-acetyl-alpha-L-rhamnose antigen name:lipopolysaccharide host organism:Mus musculus BALB/c antibody name:MASF 6-2

    Publication: 2424840;

  7. Antibody response against epitopes on hCG mapped by monoclonal antibodies in women immunized with an anti-hCG vaccine and its implications for bioneut...

    ID: 1768655

    Description: epitope description:CPTMTRVLQGVLPALPQVVC antigen name:Choriogonadotropin subunit beta host organism:Homo sapiens

    Publication: 7513023;

  8. Autoimmunogenicity of the human sperm protein Sp17 in vasectomized men and identification of linear B cell epitopes.

    ID: 1768670

    Description: epitope description:YRIPQGFGNL antigen name:Sperm surface protein Sp17 host organism:Macaca

    Publication: 9022615;

  9. Autoimmunogenicity of the human sperm protein Sp17 in vasectomized men and identification of linear B cell epitopes.

    ID: 1768671

    Description: epitope description:AVKIQAAFRG antigen name:Sperm surface protein Sp17 host organism:Macaca

    Publication: 9022615;

  10. Autoimmunogenicity of the human sperm protein Sp17 in vasectomized men and identification of linear B cell epitopes.

    ID: 1768676

    Description: epitope description:YRIPQGFGNL antigen name:Sperm surface protein Sp17 host organism:Papio

    Publication: 9022615;

  11. Characterization of the T-cell epitope that causes anti-GBM glomerulonephritis.

    ID: 1768740

    Description: epitope description:QTTANPSCPE antigen name:Protein LOC100911572 host organism:Rattus norvegicus Wistar Kyoto

    Publication: 16105036;

  12. Epitope specificity of anti-heat shock protein 65/60 serum antibodies in atherosclerosis.

    ID: 1768741

    Description: epitope description:ALVREGLRNVAAG antigen name:60 kDa chaperonin 2 (UniProt:P9WPE7) host organism:Homo sapiens

    Publication: 9102173;

  13. Characterization of the T-cell epitope that causes anti-GBM glomerulonephritis.

    ID: 1768770

    Description: epitope description:SQTTANPSCPEGT antigen name:Protein LOC100911572 host organism:Rattus norvegicus Wistar Kyoto

    Publication: 16105036;

  14. Characterization of the T-cell epitope that causes anti-GBM glomerulonephritis.

    ID: 1768772

    Description: epitope description:AQTTANPSCPEGT host organism:Rattus norvegicus Wistar Kyoto

    Publication: 16105036;

  15. Characterization of the T-cell epitope that causes anti-GBM glomerulonephritis.

    ID: 1768783

    Description: epitope description:SQTTANPSCPEGA host organism:Rattus norvegicus Wistar Kyoto

    Publication: 16105036;

  16. Identification of epitopes for cross-reaction, auto-reaction and autoantibodies to catalase.

    ID: 1768833

    Description: epitope description:KHWKEQRAAQKPDVLTTGGGNPVGDKLNSLTVGPRGPLLVQDVVFTDEM antigen name:Catalase host organism:Oryctolagus cuniculus Japanese white

    Publication: 11090242;

  17. Identification of epitopes for cross-reaction, auto-reaction and autoantibodies to catalase.

    ID: 1768834

    Description: epitope description:KHWKEQRAAQKPDVLTTGGGNPVGDKLNSLTVGPRGPLLVQDVVFTDEM antigen name:Catalase host organism:Rattus norvegicus Wistar

    Publication: 11090242;

  18. Molecular characterization of human Ro/SS-A antigen. Amino terminal sequence of the protein moiety of human Ro/SS-A antigen and immunological activity...

    ID: 1768839

    Description: epitope description:FKEQFLDGDGWTSR antigen name:Calreticulin host organism:Homo sapiens

    Publication: 3260607;

  19. Molecular characterization of human Ro/SS-A antigen. Amino terminal sequence of the protein moiety of human Ro/SS-A antigen and immunological activity...

    ID: 1768841

    Description: epitope description:KEQFLDGDGWTSRWIESK antigen name:Calreticulin host organism:Homo sapiens

    Publication: 3260607;

  20. Evidence that shed thyrotropin receptor A subunits drive affinity maturation of autoantibodies causing Graves' disease.

    ID: 1768851

    Description: epitope description:SSPPCE antigen name:Thyrotropin receptor host organism:Mus musculus NMRI antibody name:IRI-SAb2

    Publication: 19066298;

  21. Evidence that shed thyrotropin receptor A subunits drive affinity maturation of autoantibodies causing Graves' disease.

    ID: 1768852

    Description: epitope description:SSPPCE antigen name:Thyrotropin receptor host organism:Mus musculus BALB/c antibody name:KSAb1, KSAb2

    Publication: 19066298;

  22. Analysis of the human factor VIII A2 inhibitor epitope by alanine scanning mutagenesis.

    ID: 1768853

    Description: epitope description:R503, Y506, R508, P511 antigen name:Coagulation factor VIII host organism:Mus musculus antibody name:mAb413

    Publication: 9374501;

  23. Analysis of the human factor VIII A2 inhibitor epitope by alanine scanning mutagenesis.

    ID: 1768855

    Description: epitope description:Y506, S507, R508, P511, V514, F520, I527 antigen name:Coagulation factor VIII host organism:Homo sapiens antibody name:JM, RC, NS,...

    Publication: 9374501;

  24. Localization of autoepitopes on the PCM-1 autoantigen using scleroderma sera with autoantibodies against the centrosome.

    ID: 1768867

    Description: epitope description:AKFAGRKLK antigen name:Pericentriolar material 1 protein host organism:Homo sapiens

    Publication: 9540072;

  25. Localization of autoepitopes on the PCM-1 autoantigen using scleroderma sera with autoantibodies against the centrosome.

    ID: 1768871

    Description: epitope description:GEDLLVEIS antigen name:Pericentriolar material 1 protein host organism:Homo sapiens

    Publication: 9540072;

  26. Development of peptide microarrays for epitope mapping of antibodies against the human TSH receptor.

    ID: 1768880

    Description: epitope description:EEDFRV antigen name:Thyrotropin receptor host organism:Mus musculus BALB/c antibody name:28, A10

    Publication: 16920148;

  27. Development of peptide microarrays for epitope mapping of antibodies against the human TSH receptor.

    ID: 1768881

    Description: epitope description:QKKIRGILE antigen name:Thyrotropin receptor host organism:Mus musculus BALB/c antibody name:49

    Publication: 16920148;

  28. Development of peptide microarrays for epitope mapping of antibodies against the human TSH receptor.

    ID: 1768882

    Description: epitope description:QKKIRGILE antigen name:Thyrotropin receptor host organism:Mus musculus BALB/c antibody name:49

    Publication: 16920148;

  29. Development of peptide microarrays for epitope mapping of antibodies against the human TSH receptor.

    ID: 1768883

    Description: epitope description:NPCEDI antigen name:Thyrotropin receptor host organism:Mus musculus BALB/c antibody name:A7

    Publication: 16920148;

  30. Molecular cloning of canine bullous pemphigoid antigen 2 cDNA and immunomapping of NC16A domain by canine bullous pemphigoid autoantibodies.

    ID: 1768890

    Description: epitope description:EEVRKLKARVDELE antigen name:Collagen alpha-1(XVII) chain host organism:Canis lupus familiaris

    Publication: 10564722;

  31. Molecular cloning of canine bullous pemphigoid antigen 2 cDNA and immunomapping of NC16A domain by canine bullous pemphigoid autoantibodies.

    ID: 1768893

    Description: epitope description:QEELWMFVRKKLMMEQENRNLR antigen name:Collagen alpha-1(VIII) chain host organism:Canis lupus familiaris

    Publication: 10564722;

  32. Amino acid regions 572-579 and 657-666 of the spacer domain of ADAMTS13 provide a common antigenic core required for binding of antibodies in patients...

    ID: 1768898

    Description: epitope description:SPRKGSFT antigen name:A disintegrin and metalloproteinase with thrombospondin motifs 13 host organism:Homo sapiens

    Publication: 16953270;

  33. Amino acid regions 572-579 and 657-666 of the spacer domain of ADAMTS13 provide a common antigenic core required for binding of antibodies in patients...

    ID: 1768900

    Description: epitope description:TFLTVTPN antigen name:A disintegrin and metalloproteinase with thrombospondin motifs 13 host organism:Homo sapiens

    Publication: 16953270;

  34. Amino acid regions 572-579 and 657-666 of the spacer domain of ADAMTS13 provide a common antigenic core required for binding of antibodies in patients...

    ID: 1768904

    Description: epitope description:RYVVAGKMS antigen name:A disintegrin and metalloproteinase with thrombospondin motifs 13 host organism:Homo sapiens

    Publication: 16953270;

  35. Amino acid regions 572-579 and 657-666 of the spacer domain of ADAMTS13 provide a common antigenic core required for binding of antibodies in patients...

    ID: 1768910

    Description: epitope description:NLTRPDITFT antigen name:A disintegrin and metalloproteinase with thrombospondin motifs 13 host organism:Homo sapiens

    Publication: 16953270;

  36. Humoral immune responsiveness to a defined epitope on factor VIII before and after B cell ablation with rituximab.

    ID: 1768916

    Description: epitope description:NPIENMMDRDSQ host organism:Homo sapiens

    Publication: 18715645;

  37. Molecular characterization of human B domain-specific anti-factor VIII monoclonal antibodies generated in transgenic mice.

    ID: 1768921

    Description: epitope description:HIDGPSLLIEN antigen name:Coagulation factor VIII host organism:Mus musculus Xenomouse antibody name:25H3

    Publication: 17598006;

  38. Molecular characterization of human B domain-specific anti-factor VIII monoclonal antibodies generated in transgenic mice.

    ID: 1768922

    Description: epitope description:KWNEANR antigen name:Coagulation factor VIII host organism:Mus musculus Xenomouse antibody name:8E3, 22B6

    Publication: 17598006;

  39. Characterization of the anti-BP180 autoantibody reactivity profile and epitope mapping in bullous pemphigoid patients.

    ID: 1768930

    Description: epitope description:TRNSSNTLPIPKKGTVETKIVTASSQSV antigen name:Collagen alpha-1(XVII) chain host organism:Homo sapiens

    Publication: 14962097;

  40. Characterization of the anti-BP180 autoantibody reactivity profile and epitope mapping in bullous pemphigoid patients.

    ID: 1768936

    Description: epitope description:SSISSEDILAVLQRDDVRQYLRQYLMGP antigen name:Collagen alpha-1(XVII) chain host organism:Homo sapiens

    Publication: 14962097;

  41. Characterization of the anti-BP180 autoantibody reactivity profile and epitope mapping in bullous pemphigoid patients.

    ID: 1768937

    Description: epitope description:SSISSEDILAVLQRDDVRQYLRQYLMGP antigen name:Collagen alpha-1(XVII) chain host organism:Homo sapiens

    Publication: 14962097;

  42. Evidence that shed thyrotropin receptor A subunits drive affinity maturation of autoantibodies causing Graves' disease.

    ID: 1768979

    Description: epitope description:SSPPCE antigen name:Thyrotropin receptor host organism:Mus musculus BALB/c antibody name:KSAb1, KSAb2

    Publication: 19066298;

  43. B-cell repertoire specific for an unfolded self-determinant of mouse lysozyme escape tolerance and dominantly participate in the autoantibody response...

    ID: 1769112

    Description: epitope description:GDQSTDYGIFQINSR antigen name:Lysozyme C-2 host organism:Mus musculus BALB/c antibody name:8F7A, 8F10C, 3G3A, 3G1G, 7C5C, 7C5A, 9G9...

    Publication: 12460183;

  44. Localization of a metal-dependent epitope to the amino terminal residues 33-40 of human factor IX.

    ID: 1769158

    Description: epitope description:E82, R83, E86 antigen name:Coagulation factor IX host organism:Mus musculus BALB/c antibody name:A-7

    Publication: 8588203;

  45. Epitope mapping of C1 inhibitor autoantibodies from patients with acquired C1 inhibitor deficiency.

    ID: 1769160

    Description: epitope description:TETGVEAAAASAI antigen name:Plasma protease C1 inhibitor (UniProt:P05155) host organism:Homo sapiens

    Publication: 8596057;

  46. Localization of the discontinuous immunodominant region recognized by human anti-thyroperoxidase autoantibodies in autoimmune thyroid diseases.

    ID: 1769172

    Description: epitope description:H353, A354, R355, L356, R357, D358, S359, G360, R361, A362, Y363, P377, E378, P379, G380, I381, P382, G383, E384, T385, R386, K713...

    Publication: 12501244;

  47. Detailed characterization of an anti-factor IX monoclonal antibody that neutralizes the prolonged ox brain prothrombin time of hemophilia B(M) by synt...

    ID: 1769212

    Description: epitope description:ITQSTQSFNDFTRVV antigen name:Coagulation factor IX host organism:Mus musculus

    Publication: 10876041;

  48. Residues 484-508 contain a major determinant of the inhibitory epitope in the A2 domain of human factor VIII.

    ID: 1769216

    Description: epitope description:RPLYSRRLPKGVKHLKDFPILPGEIF antigen name:Coagulation factor VIII host organism:Mus musculus antibody name:MAb 413

    Publication: 7540171;

  49. A murine monoclonal anti-metallothionein autoantibody recognizes a chemically synthesized amino-terminal heptapeptide common to various animal metallo...

    ID: 1769234

    Description: epitope description:MDPNCSC + ACET(M1) antigen name:Metallothionein-2 host organism:Mus musculus BALB/c antibody name:MT 189-14-7

    Publication: 2464135;

  50. A murine monoclonal anti-factor VIII inhibitory antibody and two human factor VIII inhibitors bind to different areas within a twenty amino acid segme...

    ID: 1769242

    Description: epitope description:RMKNNEEAEDYDDDL antigen name:Coagulation factor VIII host organism:Homo sapiens

    Publication: 2129392;

  51. A murine monoclonal anti-factor VIII inhibitory antibody and two human factor VIII inhibitors bind to different areas within a twenty amino acid segme...

    ID: 1769243

    Description: epitope description:NEEAEDYDDDLTDSE antigen name:Coagulation factor VIII host organism:Homo sapiens

    Publication: 2129392;

  52. A murine monoclonal anti-factor VIII inhibitory antibody and two human factor VIII inhibitors bind to different areas within a twenty amino acid segme...

    ID: 1769244

    Description: epitope description:EAEDYDDDLTDSEMD antigen name:Coagulation factor VIII host organism:Homo sapiens

    Publication: 2129392;

  53. Differential humoral immune response against hepatitis C virus antigenic synthetic peptides in infected patients with and without mixed cryoglobulinae...

    ID: 1764706

    Description: epitope description:IIPDREVLYREFDEMEEC antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 8697636;

  54. Differential humoral immune response against hepatitis C virus antigenic synthetic peptides in infected patients with and without mixed cryoglobulinae...

    ID: 1764707

    Description: epitope description:NPPLVETWKKPDYEPP antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 8697636;

  55. Differential humoral immune response against hepatitis C virus antigenic synthetic peptides in infected patients with and without mixed cryoglobulinae...

    ID: 1764709

    Description: epitope description:CPLPPPRSPPVPPPRK antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 8697636;

  56. Epitope mapping on E1alpha subunit of pyruvate dehydrogenase complex with autoantibodies of patients with primary biliary cirrhosis.

    ID: 1764713

    Description: epitope description:REDGLKYY antigen name:Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial host organism:Homo sapiens

    Publication: 14708897;

  57. Epitope mapping on E1alpha subunit of pyruvate dehydrogenase complex with autoantibodies of patients with primary biliary cirrhosis.

    ID: 1764715

    Description: epitope description:DGLKYYRM antigen name:Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial host organism:Homo sapiens

    Publication: 14708897;

  58. Epitope mapping on E1alpha subunit of pyruvate dehydrogenase complex with autoantibodies of patients with primary biliary cirrhosis.

    ID: 1764717

    Description: epitope description:LKYYRMMQ antigen name:Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial host organism:Homo sapiens

    Publication: 14708897;

  59. Epitope mapping on E1alpha subunit of pyruvate dehydrogenase complex with autoantibodies of patients with primary biliary cirrhosis.

    ID: 1764724

    Description: epitope description:QTVRRMEL antigen name:Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial host organism:Homo sapiens

    Publication: 14708897;

  60. Epitope mapping on E1alpha subunit of pyruvate dehydrogenase complex with autoantibodies of patients with primary biliary cirrhosis.

    ID: 1764725

    Description: epitope description:TVRRMELK antigen name:Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial host organism:Homo sapiens

    Publication: 14708897;

  61. Epitope mapping on E1alpha subunit of pyruvate dehydrogenase complex with autoantibodies of patients with primary biliary cirrhosis.

    ID: 1764726

    Description: epitope description:VRRMELKA antigen name:Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial host organism:Homo sapiens

    Publication: 14708897;

  62. Epitope mapping on E1alpha subunit of pyruvate dehydrogenase complex with autoantibodies of patients with primary biliary cirrhosis.

    ID: 1764728

    Description: epitope description:RMELKADQ antigen name:Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial host organism:Homo sapiens

    Publication: 14708897;

  63. Epitope mapping on E1alpha subunit of pyruvate dehydrogenase complex with autoantibodies of patients with primary biliary cirrhosis.

    ID: 1764730

    Description: epitope description:ELKADQLY antigen name:Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial host organism:Homo sapiens

    Publication: 14708897;

  64. Epitope mapping on E1alpha subunit of pyruvate dehydrogenase complex with autoantibodies of patients with primary biliary cirrhosis.

    ID: 1764743

    Description: epitope description:KYYRMM antigen name:Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial host organism:Homo sapiens

    Publication: 14708897;

  65. Epitope mapping on E1alpha subunit of pyruvate dehydrogenase complex with autoantibodies of patients with primary biliary cirrhosis.

    ID: 1764746

    Description: epitope description:KADQLYK antigen name:Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial host organism:Homo sapiens

    Publication: 14708897;

  66. Epitope mapping on E1alpha subunit of pyruvate dehydrogenase complex with autoantibodies of patients with primary biliary cirrhosis.

    ID: 1764748

    Description: epitope description:KQKIIR antigen name:Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial host organism:Homo sapiens

    Publication: 14708897;

  67. Epitope mapping on E1alpha subunit of pyruvate dehydrogenase complex with autoantibodies of patients with primary biliary cirrhosis.

    ID: 1764750

    Description: epitope description:LACKYNGK antigen name:Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial host organism:Homo sapiens

    Publication: 14708897;

  68. Biological significance of amino acid substitutions in hepatitis B surface antigen (HBsAg) for glycosylation, secretion, antigenicity and immunogenici...

    ID: 1764795

    Description: epitope description:K122, T123, A159, K160 antigen name:Large envelope protein host organism:Mus musculus antibody name:S1, 2C8, D12, 1C10

    Publication: 19812261;

  69. Development of specific antisera and a radioimmunoassay procedure for the gonadotropin-releasing hormone associated peptide (GAP) of the LHRH prohormo...

    ID: 1764800

    Description: epitope description:FECTTHQPRSPLRDLKGALESLIEEETGQ antigen name:Progonadoliberin-1 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 3533219;

  70. Development of specific antisera and a radioimmunoassay procedure for the gonadotropin-releasing hormone associated peptide (GAP) of the LHRH prohormo...

    ID: 1764801

    Description: epitope description:FECTTHQPRSPLRDLKGALESLIEEETGQ antigen name:Progonadoliberin-1 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 3533219;

  71. Development of specific antisera and a radioimmunoassay procedure for the gonadotropin-releasing hormone associated peptide (GAP) of the LHRH prohormo...

    ID: 1764803

    Description: epitope description:FECTTHQPRSPLRDLKGALESLIEEETGQ antigen name:Progonadoliberin-1 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 3533219;

  72. Development of specific antisera and a radioimmunoassay procedure for the gonadotropin-releasing hormone associated peptide (GAP) of the LHRH prohormo...

    ID: 1764804

    Description: epitope description:FECTTHQPRSPLRDLKGALESLIEEETGQ antigen name:Progonadoliberin-1 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 3533219;

  73. Production and characterization of peptide mimotopes of phenolic glycolipid-I of Mycobacterium leprae.

    ID: 1764816

    Description: epitope description:beta-D-Glcp3,6Me2-(1->4)-alpha-L-Rhap2,3-Me2 antigen name:phenolic glycolipid-1 host organism:Mus musculus BALB/c antibody name:II...

    Publication: 15094167;

  74. Production and characterization of peptide mimotopes of phenolic glycolipid-I of Mycobacterium leprae.

    ID: 1764817

    Description: epitope description:beta-D-Glcp3,6Me2-(1->4)-alpha-L-Rhap2,3-Me2 antigen name:phenolic glycolipid-1 host organism:Homo sapiens

    Publication: 15094167;

  75. Production and characterization of peptide mimotopes of phenolic glycolipid-I of Mycobacterium leprae.

    ID: 1764819

    Description: epitope description:beta-D-Glcp3,6Me2-(1->4)-alpha-L-Rhap2,3Me2-(1->2)-alpha-L-Rhap3Me antigen name:phenolic glycolipid-1 host organism:Mus musculus B...

    Publication: 15094167;

  76. Binding of antithyrotropin receptor autoantibodies in Graves' disease serum to nascent, in vitro translated thyrotropin receptor: ability to map epito...

    ID: 1764820

    Description: epitope description:MGCSSPPCECHQEE antigen name:Thyrotropin receptor host organism:Mus musculus BALB/c antibody name:A10

    Publication: 8636291;

  77. Epitope mapping of histone 5 (H5) with systemic lupus erythematosus, procainamide-induced lupus and hydralazine-induced lupus sera.

    ID: 1764894

    Description: epitope description:RSASHP antigen name:Histone H5 host organism:Homo sapiens

    Publication: 7684819;

  78. Epitope mapping of histone 5 (H5) with systemic lupus erythematosus, procainamide-induced lupus and hydralazine-induced lupus sera.

    ID: 1764895

    Description: epitope description:SASHPT antigen name:Histone H5 host organism:Homo sapiens

    Publication: 7684819;

  79. Epitope mapping of histone 5 (H5) with systemic lupus erythematosus, procainamide-induced lupus and hydralazine-induced lupus sera.

    ID: 1764896

    Description: epitope description:ASHPTY antigen name:Histone H5 host organism:Homo sapiens

    Publication: 7684819;

  80. Epitope mapping of histone 5 (H5) with systemic lupus erythematosus, procainamide-induced lupus and hydralazine-induced lupus sera.

    ID: 1764902

    Description: epitope description:SEMIAA antigen name:Histone H5 host organism:Homo sapiens

    Publication: 7684819;

  81. Epitope mapping of histone 5 (H5) with systemic lupus erythematosus, procainamide-induced lupus and hydralazine-induced lupus sera.

    ID: 1764908

    Description: epitope description:AIRAEK antigen name:Histone H5 host organism:Homo sapiens

    Publication: 7684819;

  82. Epitope mapping of histone 5 (H5) with systemic lupus erythematosus, procainamide-induced lupus and hydralazine-induced lupus sera.

    ID: 1764911

    Description: epitope description:AEKSRG antigen name:Histone H5 host organism:Homo sapiens

    Publication: 7684819;

  83. Epitope mapping of histone 5 (H5) with systemic lupus erythematosus, procainamide-induced lupus and hydralazine-induced lupus sera.

    ID: 1764916

    Description: epitope description:GGSSRQ antigen name:Histone H5 host organism:Homo sapiens

    Publication: 7684819;

  84. Epitope mapping of histone 5 (H5) with systemic lupus erythematosus, procainamide-induced lupus and hydralazine-induced lupus sera.

    ID: 1764919

    Description: epitope description:SRQSIQ antigen name:Histone H5 host organism:Homo sapiens

    Publication: 7684819;

  85. Epitope mapping of histone 5 (H5) with systemic lupus erythematosus, procainamide-induced lupus and hydralazine-induced lupus sera.

    ID: 1764931

    Description: epitope description:YKVGHN antigen name:Histone H5 host organism:Homo sapiens

    Publication: 7684819;

  86. Epitope mapping of histone 5 (H5) with systemic lupus erythematosus, procainamide-induced lupus and hydralazine-induced lupus sera.

    ID: 1764934

    Description: epitope description:GHNADL antigen name:Histone H5 host organism:Homo sapiens

    Publication: 7684819;

  87. Epitope mapping of histone 5 (H5) with systemic lupus erythematosus, procainamide-induced lupus and hydralazine-induced lupus sera.

    ID: 1764940

    Description: epitope description:QIKLSI antigen name:Histone H5 host organism:Homo sapiens

    Publication: 7684819;

  88. Epitope mapping of histone 5 (H5) with systemic lupus erythematosus, procainamide-induced lupus and hydralazine-induced lupus sera.

    ID: 1764941

    Description: epitope description:IKLSIR antigen name:Histone H5 host organism:Homo sapiens

    Publication: 7684819;

  89. Epitope mapping of histone 5 (H5) with systemic lupus erythematosus, procainamide-induced lupus and hydralazine-induced lupus sera.

    ID: 1764954

    Description: epitope description:LKQTKG antigen name:Histone H5 host organism:Homo sapiens

    Publication: 7684819;

  90. Epitope mapping of histone 5 (H5) with systemic lupus erythematosus, procainamide-induced lupus and hydralazine-induced lupus sera.

    ID: 1764961

    Description: epitope description:GASGSF antigen name:Histone H5 host organism:Homo sapiens

    Publication: 7684819;

  91. Epitope mapping of histone 5 (H5) with systemic lupus erythematosus, procainamide-induced lupus and hydralazine-induced lupus sera.

    ID: 1764967

    Description: epitope description:RLAKSD antigen name:Histone H5 host organism:Homo sapiens

    Publication: 7684819;

  92. Epitope mapping of histone 5 (H5) with systemic lupus erythematosus, procainamide-induced lupus and hydralazine-induced lupus sera.

    ID: 1764970

    Description: epitope description:KSDKAK antigen name:Histone H5 host organism:Homo sapiens

    Publication: 7684819;

  93. Epitope mapping of histone 5 (H5) with systemic lupus erythematosus, procainamide-induced lupus and hydralazine-induced lupus sera.

    ID: 1764972

    Description: epitope description:DKAKRS antigen name:Histone H5 host organism:Homo sapiens

    Publication: 7684819;

  94. Epitope mapping of histone 5 (H5) with systemic lupus erythematosus, procainamide-induced lupus and hydralazine-induced lupus sera.

    ID: 1764974

    Description: epitope description:AKRSPG antigen name:Histone H5 host organism:Homo sapiens

    Publication: 7684819;

  95. Epitope mapping of histone 5 (H5) with systemic lupus erythematosus, procainamide-induced lupus and hydralazine-induced lupus sera.

    ID: 1764976

    Description: epitope description:RSPGKK antigen name:Histone H5 host organism:Homo sapiens

    Publication: 7684819;

  96. Epitope mapping of histone 5 (H5) with systemic lupus erythematosus, procainamide-induced lupus and hydralazine-induced lupus sera.

    ID: 1764978

    Description: epitope description:PGKKKK antigen name:Histone H5 host organism:Homo sapiens

    Publication: 7684819;

  97. Epitope mapping of histone 5 (H5) with systemic lupus erythematosus, procainamide-induced lupus and hydralazine-induced lupus sera.

    ID: 1764984

    Description: epitope description:AVRRST antigen name:Histone H5 host organism:Homo sapiens

    Publication: 7684819;

  98. Epitope mapping of histone 5 (H5) with systemic lupus erythematosus, procainamide-induced lupus and hydralazine-induced lupus sera.

    ID: 1764990

    Description: epitope description:SPKKAA antigen name:Histone H5 host organism:Homo sapiens

    Publication: 7684819;

  99. Epitope mapping of histone 5 (H5) with systemic lupus erythematosus, procainamide-induced lupus and hydralazine-induced lupus sera.

    ID: 1764999

    Description: epitope description:KARSPA antigen name:Histone H5 host organism:Homo sapiens

    Publication: 7684819;

  100. Epitope mapping of histone 5 (H5) with systemic lupus erythematosus, procainamide-induced lupus and hydralazine-induced lupus sera.

    ID: 1765000

    Description: epitope description:ARSPAK antigen name:Histone H5 host organism:Homo sapiens

    Publication: 7684819;
Displaying 100 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston