Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Towards a solution for hepatitis C virus hypervariability: mimotopes of the hypervariable region 1 can induce antibodies cross-reacting with a large n...

    ID: 1301357

    Description: epitope description:STRITAQAEGRGASTLTSLFTSGASQK antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 9649423;

  2. Towards a solution for hepatitis C virus hypervariability: mimotopes of the hypervariable region 1 can induce antibodies cross-reacting with a large n...

    ID: 1301381

    Description: epitope description:STIVSGGTVARTTHSLASLFTQGASQK antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 9649423;

  3. Towards a solution for hepatitis C virus hypervariability: mimotopes of the hypervariable region 1 can induce antibodies cross-reacting with a large n...

    ID: 1301383

    Description: epitope description:STIVSGGTVARTTHSLASLFTQGASQK antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 9649423;

  4. Towards a solution for hepatitis C virus hypervariability: mimotopes of the hypervariable region 1 can induce antibodies cross-reacting with a large n...

    ID: 1301392

    Description: epitope description:STIVSGGTVARTTHSLASLFTQGASQK antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 9649423;

  5. Towards a solution for hepatitis C virus hypervariability: mimotopes of the hypervariable region 1 can induce antibodies cross-reacting with a large n...

    ID: 1301394

    Description: epitope description:STIVSGGTVARTTHSLASLFTQGASQK antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 9649423;

  6. Towards a solution for hepatitis C virus hypervariability: mimotopes of the hypervariable region 1 can induce antibodies cross-reacting with a large n...

    ID: 1301436

    Description: epitope description:ETRVTGGAAGHTAFGFASFLAPGAKQK antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 9649423;

  7. Towards a solution for hepatitis C virus hypervariability: mimotopes of the hypervariable region 1 can induce antibodies cross-reacting with a large n...

    ID: 1301469

    Description: epitope description:NTYVTGGSAGRAVAGFAGLLQPGAKQN antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 9649423;

  8. Towards a solution for hepatitis C virus hypervariability: mimotopes of the hypervariable region 1 can induce antibodies cross-reacting with a large n...

    ID: 1301494

    Description: epitope description:ETHSVGGSAAHTTSRFTSLFSPGPQQN antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 9649423;

  9. Towards a solution for hepatitis C virus hypervariability: mimotopes of the hypervariable region 1 can induce antibodies cross-reacting with a large n...

    ID: 1301495

    Description: epitope description:ETHSVGGSAAHTTSRFTSLFSPGPQQN antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 9649423;

  10. Towards a solution for hepatitis C virus hypervariability: mimotopes of the hypervariable region 1 can induce antibodies cross-reacting with a large n...

    ID: 1301496

    Description: epitope description:ETHSVGGSAAHTTSRFTSLFSPGPQQN antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 9649423;

  11. Towards a solution for hepatitis C virus hypervariability: mimotopes of the hypervariable region 1 can induce antibodies cross-reacting with a large n...

    ID: 1301497

    Description: epitope description:ETHSVGGSAAHTTSRFTSLFSPGPQQN antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 9649423;

  12. Towards a solution for hepatitis C virus hypervariability: mimotopes of the hypervariable region 1 can induce antibodies cross-reacting with a large n...

    ID: 1301500

    Description: epitope description:ETHSVGGSAAHTTSRFTSLFSPGPQQN antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 9649423;

  13. Towards a solution for hepatitis C virus hypervariability: mimotopes of the hypervariable region 1 can induce antibodies cross-reacting with a large n...

    ID: 1301531

    Description: epitope description:ETHVTGGSAASTTSTLTKLFMPGASQN antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 9649423;

  14. Towards a solution for hepatitis C virus hypervariability: mimotopes of the hypervariable region 1 can induce antibodies cross-reacting with a large n...

    ID: 1301536

    Description: epitope description:ETHVTGGSAASTTSTLTKLFMPGASQN antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 9649423;

  15. Towards a solution for hepatitis C virus hypervariability: mimotopes of the hypervariable region 1 can induce antibodies cross-reacting with a large n...

    ID: 1301543

    Description: epitope description:ETHVTGGSAASTTSTLTKLFMPGASQN antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 9649423;

  16. Towards a solution for hepatitis C virus hypervariability: mimotopes of the hypervariable region 1 can induce antibodies cross-reacting with a large n...

    ID: 1301569

    Description: epitope description:QTRTVGGANARNTYGLTTLFTTGPKQN antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 9649423;

  17. Towards a solution for hepatitis C virus hypervariability: mimotopes of the hypervariable region 1 can induce antibodies cross-reacting with a large n...

    ID: 1301599

    Description: epitope description:GTTTVGSAVSSTTYRFAGMFSQGAQQN antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 9649423;

  18. Towards a solution for hepatitis C virus hypervariability: mimotopes of the hypervariable region 1 can induce antibodies cross-reacting with a large n...

    ID: 1301601

    Description: epitope description:GTTTVGSAVSSTTYRFAGMFSQGAQQN antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 9649423;

  19. Towards a solution for hepatitis C virus hypervariability: mimotopes of the hypervariable region 1 can induce antibodies cross-reacting with a large n...

    ID: 1301611

    Description: epitope description:GTTTVGSAVSSTTYRFAGMFSQGAQQN antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 9649423;

  20. Towards a solution for hepatitis C virus hypervariability: mimotopes of the hypervariable region 1 can induce antibodies cross-reacting with a large n...

    ID: 1301613

    Description: epitope description:GTTTVGSAVSSTTYRFAGMFSQGAQQN antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 9649423;

  21. Towards a solution for hepatitis C virus hypervariability: mimotopes of the hypervariable region 1 can induce antibodies cross-reacting with a large n...

    ID: 1301614

    Description: epitope description:GTTTVGSAVSSTTYRFAGMFSQGAQQN antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 9649423;

  22. Towards a solution for hepatitis C virus hypervariability: mimotopes of the hypervariable region 1 can induce antibodies cross-reacting with a large n...

    ID: 1301635

    Description: epitope description:NTHTVGGTEGFATQRLTSLFALGPSQK antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 9649423;

  23. Towards a solution for hepatitis C virus hypervariability: mimotopes of the hypervariable region 1 can induce antibodies cross-reacting with a large n...

    ID: 1301638

    Description: epitope description:NTHTVGGTEGFATQRLTSLFALGPSQK antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 9649423;

  24. Towards a solution for hepatitis C virus hypervariability: mimotopes of the hypervariable region 1 can induce antibodies cross-reacting with a large n...

    ID: 1301675

    Description: epitope description:NTHVTGGVVARNAYRITTFLNPGPAQN antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 9649423;

  25. Towards a solution for hepatitis C virus hypervariability: mimotopes of the hypervariable region 1 can induce antibodies cross-reacting with a large n...

    ID: 1301680

    Description: epitope description:NTHVTGGVVARNAYRITTFLNPGPAQN antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 9649423;

  26. Towards a solution for hepatitis C virus hypervariability: mimotopes of the hypervariable region 1 can induce antibodies cross-reacting with a large n...

    ID: 1301750

    Description: epitope description:KTHVTGMVAGKNAHTLSSIFTSGPSQN antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 9649423;

  27. Towards a solution for hepatitis C virus hypervariability: mimotopes of the hypervariable region 1 can induce antibodies cross-reacting with a large n...

    ID: 1301782

    Description: epitope description:GTHVTGGKVAYTTQGFTSFFSRGPSQK antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 9649423;

  28. Towards a solution for hepatitis C virus hypervariability: mimotopes of the hypervariable region 1 can induce antibodies cross-reacting with a large n...

    ID: 1301798

    Description: epitope description:ETYTSGGNAGHTMTGIVRFFAPGPKQN antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 9649423;

  29. Towards a solution for hepatitis C virus hypervariability: mimotopes of the hypervariable region 1 can induce antibodies cross-reacting with a large n...

    ID: 1301802

    Description: epitope description:ETYTSGGNAGHTMTGIVRFFAPGPKQN antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 9649423;

  30. Towards a solution for hepatitis C virus hypervariability: mimotopes of the hypervariable region 1 can induce antibodies cross-reacting with a large n...

    ID: 1301808

    Description: epitope description:ETYTSGGNAGHTMTGIVRFFAPGPKQN antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 9649423;

  31. Towards a solution for hepatitis C virus hypervariability: mimotopes of the hypervariable region 1 can induce antibodies cross-reacting with a large n...

    ID: 1301814

    Description: epitope description:ETYTSGGNAGHTMTGIVRFFAPGPKQN antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 9649423;

  32. Towards a solution for hepatitis C virus hypervariability: mimotopes of the hypervariable region 1 can induce antibodies cross-reacting with a large n...

    ID: 1301844

    Description: epitope description:STYSMGGAAAHNARGLTSLFSSGASQR antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 9649423;

  33. Towards a solution for hepatitis C virus hypervariability: mimotopes of the hypervariable region 1 can induce antibodies cross-reacting with a large n...

    ID: 1301873

    Description: epitope description:ETHVTGGSAGRSVLGIASFLTRGPKQN antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 9649423;

  34. Towards a solution for hepatitis C virus hypervariability: mimotopes of the hypervariable region 1 can induce antibodies cross-reacting with a large n...

    ID: 1301896

    Description: epitope description:ETYIIGAATGRTTAGLTSLFSSGSQQN antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 9649423;

  35. Towards a solution for hepatitis C virus hypervariability: mimotopes of the hypervariable region 1 can induce antibodies cross-reacting with a large n...

    ID: 1301927

    Description: epitope description:ETHVTGGNAGRTTAGLVGLLTPGAKQN antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 9649423;

  36. Towards a solution for hepatitis C virus hypervariability: mimotopes of the hypervariable region 1 can induce antibodies cross-reacting with a large n...

    ID: 1301935

    Description: epitope description:ETHVTGGNAGRTTAGLVGLLTPGAKQN antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 9649423;

  37. Towards a solution for hepatitis C virus hypervariability: mimotopes of the hypervariable region 1 can induce antibodies cross-reacting with a large n...

    ID: 1301936

    Description: epitope description:ETHVTGGNAGRTTAGLVGLLTPGAKQN antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 9649423;

  38. Towards a solution for hepatitis C virus hypervariability: mimotopes of the hypervariable region 1 can induce antibodies cross-reacting with a large n...

    ID: 1301939

    Description: epitope description:ETHVTGGNAGRTTAGLVGLLTPGAKQN antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 9649423;

  39. Towards a solution for hepatitis C virus hypervariability: mimotopes of the hypervariable region 1 can induce antibodies cross-reacting with a large n...

    ID: 1301990

    Description: epitope description:NTRVTGGVQSHTTRGFVGMFSLGPSQR antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 9649423;

  40. Towards a solution for hepatitis C virus hypervariability: mimotopes of the hypervariable region 1 can induce antibodies cross-reacting with a large n...

    ID: 1302006

    Description: epitope description:NTRVTGGVQSHTTRGFVGMFSLGPSQR antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 9649423;

  41. Mapping the prion protein using recombinant antibodies.

    ID: 1302480

    Description: epitope description:AMSRPMIHFGNDWEDRYYRENMYRY antigen name:Major prion protein host organism:Mus musculus PrP null antibody name:D18

    Publication: 9765500;

  42. Mapping the prion protein using recombinant antibodies.

    ID: 1302483

    Description: epitope description:AMSRPMIHFGNDWEDRYYRENMYRY antigen name:Major prion protein host organism:Mus musculus PrP null antibody name:D18

    Publication: 9765500;

  43. Advances in alfalfa mosaic virus-mediated expression of anthrax antigen in planta.

    ID: 1309249

    Description: epitope description:EGLKEVINDRYDMLN antigen name:Protective antigen host organism:Mus musculus BALB/c

    Publication: 16236249;

  44. Hepatitis E virus: identification of type-common epitopes.

    ID: 1311986

    Description: epitope description:ANQPGHLAPLGEIRPSAPPLPPVADLPQPGLRR antigen name:Protein ORF3 host organism:Macaca fascicularis antibody name:C-130

    Publication: 1717709;

  45. Hepatitis E virus: identification of type-common epitopes.

    ID: 1311988

    Description: epitope description:TFDYPGRAHTFDDFCPECRALGLQGCAFQSTVAELQRLKVKV antigen name:Capsid protein host organism:Macaca fascicularis antibody name:C-130

    Publication: 1717709;

  46. Hepatitis E virus: identification of type-common epitopes.

    ID: 1311992

    Description: epitope description:TLDYPARAHTFDDFCPECRPLGLQGCAFQSTVAELQRLKMKV antigen name:Capsid protein host organism:Macaca fascicularis antibody name:C-130

    Publication: 1717709;

  47. Hepatitis E virus: identification of type-common epitopes.

    ID: 1311993

    Description: epitope description:TLDYPARAHTFDDFCPECRPLGLQGCAFQSTVAELQRLKMKV antigen name:Capsid protein host organism:Macaca fascicularis antibody name:C-30

    Publication: 1717709;

  48. Monoclonal antibodies to the hypervariable region 1 of hepatitis C virus capture virus and inhibit virus adsorption to susceptible cells in vitro.

    ID: 1311995

    Description: epitope description:HTRVTGGVQG antigen name:Genome polyprotein host organism:Mus musculus C57BL/6 antibody name:30F1

    Publication: 10753706;

  49. Mapping of serotype-specific, immunodominant epitopes in the NS-4 region of hepatitis C virus (HCV): use of type-specific peptides to serologically di...

    ID: 1312000

    Description: epitope description:ALIEEGQRM antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7686182;

  50. Mapping of serotype-specific, immunodominant epitopes in the NS-4 region of hepatitis C virus (HCV): use of type-specific peptides to serologically di...

    ID: 1312010

    Description: epitope description:AEMLKSKIQ antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7686182;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston