Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "

  1. Elevated antibodies to synthetic peptides of HTLV-1 envelope transmembrane glycoproteins in patients with HAM/TSP.

    ID: 1384331

    Description: epitope description:QHDVNFTQEVSRLNINLHFSKCGFPF antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 1955565;

  2. Elevated antibodies to synthetic peptides of HTLV-1 envelope transmembrane glycoproteins in patients with HAM/TSP.

    ID: 1384333

    Description: epitope description:FLNTEPSQLPPTAPPLLPHSNLDHI antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 1955565;

  3. Elevated antibodies to synthetic peptides of HTLV-1 envelope transmembrane glycoproteins in patients with HAM/TSP.

    ID: 1384337

    Description: epitope description:LVQLTLQSTNYTCIVCIDRASLST antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 1955565;

  4. Elevated antibodies to synthetic peptides of HTLV-1 envelope transmembrane glycoproteins in patients with HAM/TSP.

    ID: 1384338

    Description: epitope description:STWHVLYSPNVSVPSSSSTP antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 1955565;

  5. Elevated antibodies to synthetic peptides of HTLV-1 envelope transmembrane glycoproteins in patients with HAM/TSP.

    ID: 1384352

    Description: epitope description:CRFPNITNSHVPILQERPPLENRVLTGYGL host organism:Homo sapiens

    Publication: 1955565;

  6. Elevated antibodies to synthetic peptides of HTLV-1 envelope transmembrane glycoproteins in patients with HAM/TSP.

    ID: 1384360

    Description: epitope description:FLNTEPSQLPPTAPPLLPHSNLDHI antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 1955565;

  7. Delineation of contiguous determinants essential for biological functions of the pre-S sequence of the hepatitis B virus envelope protein: its antigen...

    ID: 1384383

    Description: epitope description:STTFHQTLQDPRVRGLYFPAGGSSSGTVNP antigen name:Large envelope protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2462893;

  8. Delineation of contiguous determinants essential for biological functions of the pre-S sequence of the hepatitis B virus envelope protein: its antigen...

    ID: 1384391

    Description: epitope description:MQWNSTAFHQTLQDPRVRGLYLPAGGSSSGTVNP antigen name:Large envelope protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2462893;

  9. Delineation of contiguous determinants essential for biological functions of the pre-S sequence of the hepatitis B virus envelope protein: its antigen...

    ID: 1384394

    Description: epitope description:MQWNSTAFHQTLQDPRVRGLYLPAGG antigen name:Large envelope protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2462893;

  10. Monoclonal antibody against non-dominant epitopes of HBV e Ag was raised by antigen-antibody co-immunization.

    ID: 1384396

    Description: epitope description:LVSFGVWIRTPPAYRPPN antigen name:External core antigen host organism:Mus musculus antibody name:EWB

    Publication: 17408795;
Displaying 10 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston