Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 100 of 1,510,353 results for " "

  1. Epitope mapping of histone 5 (H5) with systemic lupus erythematosus, procainamide-induced lupus and hydralazine-induced lupus sera.

    ID: 1765001

    Description: epitope description:RSPAKK antigen name:Histone H5 host organism:Homo sapiens

    Publication: 7684819;

  2. Epitope mapping of histone 5 (H5) with systemic lupus erythematosus, procainamide-induced lupus and hydralazine-induced lupus sera.

    ID: 1765002

    Description: epitope description:SPAKKP antigen name:Histone H5 host organism:Homo sapiens

    Publication: 7684819;

  3. Epitope mapping of histone 5 (H5) with systemic lupus erythematosus, procainamide-induced lupus and hydralazine-induced lupus sera.

    ID: 1765022

    Description: epitope description:PKKAKK antigen name:Histone H5 host organism:Homo sapiens

    Publication: 7684819;

  4. Epitope mapping of histone 5 (H5) with systemic lupus erythematosus, procainamide-induced lupus and hydralazine-induced lupus sera.

    ID: 1765028

    Description: epitope description:PKTVKA antigen name:Histone H5 host organism:Homo sapiens

    Publication: 7684819;

  5. Epitope mapping of histone 5 (H5) with systemic lupus erythematosus, procainamide-induced lupus and hydralazine-induced lupus sera.

    ID: 1765035

    Description: epitope description:SRKASK antigen name:Histone H5 host organism:Homo sapiens

    Publication: 7684819;

  6. Epitope mapping of histone 5 (H5) with systemic lupus erythematosus, procainamide-induced lupus and hydralazine-induced lupus sera.

    ID: 1765037

    Description: epitope description:KASKAK antigen name:Histone H5 host organism:Homo sapiens

    Publication: 7684819;

  7. Epitope mapping of histone 5 (H5) with systemic lupus erythematosus, procainamide-induced lupus and hydralazine-induced lupus sera.

    ID: 1765041

    Description: epitope description:AKKVKR antigen name:Histone H5 host organism:Homo sapiens

    Publication: 7684819;

  8. Epitope mapping of histone 5 (H5) with systemic lupus erythematosus, procainamide-induced lupus and hydralazine-induced lupus sera.

    ID: 1765097

    Description: epitope description:LVLSPA antigen name:Histone H5 host organism:Homo sapiens

    Publication: 7684819;

  9. Epitope mapping of histone 5 (H5) with systemic lupus erythematosus, procainamide-induced lupus and hydralazine-induced lupus sera.

    ID: 1765123

    Description: epitope description:KASRRS antigen name:Histone H5 host organism:Homo sapiens

    Publication: 7684819;

  10. Epitope mapping of histone 5 (H5) with systemic lupus erythematosus, procainamide-induced lupus and hydralazine-induced lupus sera.

    ID: 1765130

    Description: epitope description:RSASHP antigen name:Histone H5 host organism:Homo sapiens

    Publication: 7684819;

  11. Epitope mapping of histone 5 (H5) with systemic lupus erythematosus, procainamide-induced lupus and hydralazine-induced lupus sera.

    ID: 1765135

    Description: epitope description:ASHPTY antigen name:Histone H5 host organism:Homo sapiens

    Publication: 7684819;

  12. Epitope mapping of histone 5 (H5) with systemic lupus erythematosus, procainamide-induced lupus and hydralazine-induced lupus sera.

    ID: 1765138

    Description: epitope description:HPTYSE antigen name:Histone H5 host organism:Homo sapiens

    Publication: 7684819;

  13. Epitope mapping of histone 5 (H5) with systemic lupus erythematosus, procainamide-induced lupus and hydralazine-induced lupus sera.

    ID: 1765143

    Description: epitope description:TYSEMI antigen name:Histone H5 host organism:Homo sapiens

    Publication: 7684819;

  14. Epitope mapping of histone 5 (H5) with systemic lupus erythematosus, procainamide-induced lupus and hydralazine-induced lupus sera.

    ID: 1765144

    Description: epitope description:YSEMIA antigen name:Histone H5 host organism:Homo sapiens

    Publication: 7684819;

  15. Epitope mapping of histone 5 (H5) with systemic lupus erythematosus, procainamide-induced lupus and hydralazine-induced lupus sera.

    ID: 1765149

    Description: epitope description:EMIAAA antigen name:Histone H5 host organism:Homo sapiens

    Publication: 7684819;

  16. Epitope mapping of histone 5 (H5) with systemic lupus erythematosus, procainamide-induced lupus and hydralazine-induced lupus sera.

    ID: 1765152

    Description: epitope description:IAAAIR antigen name:Histone H5 host organism:Homo sapiens

    Publication: 7684819;

  17. Epitope mapping of histone 5 (H5) with systemic lupus erythematosus, procainamide-induced lupus and hydralazine-induced lupus sera.

    ID: 1765155

    Description: epitope description:AAAIRA antigen name:Histone H5 host organism:Homo sapiens

    Publication: 7684819;

  18. Epitope mapping of histone 5 (H5) with systemic lupus erythematosus, procainamide-induced lupus and hydralazine-induced lupus sera.

    ID: 1765157

    Description: epitope description:AAIRAE antigen name:Histone H5 host organism:Homo sapiens

    Publication: 7684819;

  19. Epitope mapping of histone 5 (H5) with systemic lupus erythematosus, procainamide-induced lupus and hydralazine-induced lupus sera.

    ID: 1765166

    Description: epitope description:EKSRGG antigen name:Histone H5 host organism:Homo sapiens

    Publication: 7684819;

  20. Epitope mapping of histone 5 (H5) with systemic lupus erythematosus, procainamide-induced lupus and hydralazine-induced lupus sera.

    ID: 1765167

    Description: epitope description:EKSRGG antigen name:Histone H5 host organism:Homo sapiens

    Publication: 7684819;

  21. Epitope mapping of histone 5 (H5) with systemic lupus erythematosus, procainamide-induced lupus and hydralazine-induced lupus sera.

    ID: 1765169

    Description: epitope description:KSRGGS antigen name:Histone H5 host organism:Homo sapiens

    Publication: 7684819;

  22. Epitope mapping of histone 5 (H5) with systemic lupus erythematosus, procainamide-induced lupus and hydralazine-induced lupus sera.

    ID: 1765178

    Description: epitope description:SSRQSI antigen name:Histone H5 host organism:Homo sapiens

    Publication: 7684819;

  23. Epitope mapping of histone 5 (H5) with systemic lupus erythematosus, procainamide-induced lupus and hydralazine-induced lupus sera.

    ID: 1765180

    Description: epitope description:SRQSIQ antigen name:Histone H5 host organism:Homo sapiens

    Publication: 7684819;

  24. Epitope mapping of histone 5 (H5) with systemic lupus erythematosus, procainamide-induced lupus and hydralazine-induced lupus sera.

    ID: 1765184

    Description: epitope description:QSIQKY antigen name:Histone H5 host organism:Homo sapiens

    Publication: 7684819;

  25. Epitope mapping of histone 5 (H5) with systemic lupus erythematosus, procainamide-induced lupus and hydralazine-induced lupus sera.

    ID: 1765187

    Description: epitope description:SIQKYI antigen name:Histone H5 host organism:Homo sapiens

    Publication: 7684819;

  26. Epitope mapping of histone 5 (H5) with systemic lupus erythematosus, procainamide-induced lupus and hydralazine-induced lupus sera.

    ID: 1765194

    Description: epitope description:YIKSHY antigen name:Histone H5 host organism:Homo sapiens

    Publication: 7684819;

  27. Epitope mapping of histone 5 (H5) with systemic lupus erythematosus, procainamide-induced lupus and hydralazine-induced lupus sera.

    ID: 1765195

    Description: epitope description:YIKSHY antigen name:Histone H5 host organism:Homo sapiens

    Publication: 7684819;

  28. Epitope mapping of histone 5 (H5) with systemic lupus erythematosus, procainamide-induced lupus and hydralazine-induced lupus sera.

    ID: 1765197

    Description: epitope description:IKSHYK antigen name:Histone H5 host organism:Homo sapiens

    Publication: 7684819;

  29. Epitope mapping of histone 5 (H5) with systemic lupus erythematosus, procainamide-induced lupus and hydralazine-induced lupus sera.

    ID: 1765199

    Description: epitope description:KSHYKV antigen name:Histone H5 host organism:Homo sapiens

    Publication: 7684819;

  30. Epitope mapping of histone 5 (H5) with systemic lupus erythematosus, procainamide-induced lupus and hydralazine-induced lupus sera.

    ID: 1765203

    Description: epitope description:HYKVGH antigen name:Histone H5 host organism:Homo sapiens

    Publication: 7684819;

  31. Epitope mapping of histone 5 (H5) with systemic lupus erythematosus, procainamide-induced lupus and hydralazine-induced lupus sera.

    ID: 1765205

    Description: epitope description:YKVGHN antigen name:Histone H5 host organism:Homo sapiens

    Publication: 7684819;

  32. Molecular localization of human IgG anti-F(ab')2 reactivity with variable- and constant-region lambda light-chain epitopes.

    ID: 1770183

    Description: epitope description:QVFGGGT antigen name:Immunoglobulin host organism:Homo sapiens

    Publication: 8576321;

  33. Molecular localization of human IgG anti-F(ab')2 reactivity with variable- and constant-region lambda light-chain epitopes.

    ID: 1770184

    Description: epitope description:VFGGGTR antigen name:Immunoglobulin host organism:Homo sapiens

    Publication: 8576321;

  34. Molecular localization of human IgG anti-F(ab')2 reactivity with variable- and constant-region lambda light-chain epitopes.

    ID: 1770202

    Description: epitope description:LQANKAT antigen name:Immunoglobulin host organism:Homo sapiens

    Publication: 8576321;

  35. Molecular localization of human IgG anti-F(ab')2 reactivity with variable- and constant-region lambda light-chain epitopes.

    ID: 1770206

    Description: epitope description:KATLVCL antigen name:Immunoglobulin host organism:Homo sapiens

    Publication: 8576321;

  36. Molecular localization of human IgG anti-F(ab')2 reactivity with variable- and constant-region lambda light-chain epitopes.

    ID: 1770213

    Description: epitope description:ISDFYPG antigen name:Immunoglobulin host organism:Homo sapiens

    Publication: 8576321;

  37. Molecular localization of human IgG anti-F(ab')2 reactivity with variable- and constant-region lambda light-chain epitopes.

    ID: 1770215

    Description: epitope description:DFYPGAV antigen name:Immunoglobulin host organism:Homo sapiens

    Publication: 8576321;

  38. Molecular localization of human IgG anti-F(ab')2 reactivity with variable- and constant-region lambda light-chain epitopes.

    ID: 1770217

    Description: epitope description:YPGAVTV antigen name:Immunoglobulin host organism:Homo sapiens

    Publication: 8576321;

  39. Molecular localization of human IgG anti-F(ab')2 reactivity with variable- and constant-region lambda light-chain epitopes.

    ID: 1770221

    Description: epitope description:VTVAWKA antigen name:Immunoglobulin host organism:Homo sapiens

    Publication: 8576321;

  40. Molecular localization of human IgG anti-F(ab')2 reactivity with variable- and constant-region lambda light-chain epitopes.

    ID: 1770225

    Description: epitope description:WKAPSSP antigen name:BRCA1-associated RING domain protein 1 host organism:Homo sapiens

    Publication: 8576321;

  41. Molecular localization of human IgG anti-F(ab')2 reactivity with variable- and constant-region lambda light-chain epitopes.

    ID: 1770228

    Description: epitope description:PSSPVKA antigen name:BRCA1-associated RING domain protein 1 host organism:Homo sapiens

    Publication: 8576321;

  42. Molecular localization of human IgG anti-F(ab')2 reactivity with variable- and constant-region lambda light-chain epitopes.

    ID: 1770229

    Description: epitope description:SSPVKAG antigen name:Immunoglobulin host organism:Homo sapiens

    Publication: 8576321;

  43. Molecular localization of human IgG anti-F(ab')2 reactivity with variable- and constant-region lambda light-chain epitopes.

    ID: 1770232

    Description: epitope description:VKAGVET antigen name:Immunoglobulin host organism:Homo sapiens

    Publication: 8576321;

  44. Molecular localization of human IgG anti-F(ab')2 reactivity with variable- and constant-region lambda light-chain epitopes.

    ID: 1770239

    Description: epitope description:TTPSKQS antigen name:Immunoglobulin host organism:Homo sapiens

    Publication: 8576321;

  45. Molecular localization of human IgG anti-F(ab')2 reactivity with variable- and constant-region lambda light-chain epitopes.

    ID: 1770250

    Description: epitope description:AASSYLS antigen name:Immunoglobulin host organism:Homo sapiens

    Publication: 8576321;

  46. Molecular localization of human IgG anti-F(ab')2 reactivity with variable- and constant-region lambda light-chain epitopes.

    ID: 1770252

    Description: epitope description:SSYLSLT antigen name:Immunoglobulin host organism:Homo sapiens

    Publication: 8576321;

  47. Molecular localization of human IgG anti-F(ab')2 reactivity with variable- and constant-region lambda light-chain epitopes.

    ID: 1770259

    Description: epitope description:PEQWKSH antigen name:Immunoglobulin host organism:Homo sapiens

    Publication: 8576321;

  48. Molecular localization of human IgG anti-F(ab')2 reactivity with variable- and constant-region lambda light-chain epitopes.

    ID: 1770265

    Description: epitope description:HRSYSCQ antigen name:Immunoglobulin host organism:Homo sapiens

    Publication: 8576321;

  49. Molecular localization of human IgG anti-F(ab')2 reactivity with variable- and constant-region lambda light-chain epitopes.

    ID: 1770266

    Description: epitope description:RSYSCQV antigen name:Immunoglobulin host organism:Homo sapiens

    Publication: 8576321;

  50. Molecular localization of human IgG anti-F(ab')2 reactivity with variable- and constant-region lambda light-chain epitopes.

    ID: 1770267

    Description: epitope description:SYSCQVT antigen name:Immunoglobulin host organism:Homo sapiens

    Publication: 8576321;

  51. Molecular localization of human IgG anti-F(ab')2 reactivity with variable- and constant-region lambda light-chain epitopes.

    ID: 1770274

    Description: epitope description:SASASLG antigen name:Immunoglobulin host organism:Homo sapiens

    Publication: 8576321;

  52. Molecular localization of human IgG anti-F(ab')2 reactivity with variable- and constant-region lambda light-chain epitopes.

    ID: 1770279

    Description: epitope description:LGASVKV antigen name:Immunoglobulin host organism:Homo sapiens

    Publication: 8576321;

  53. Molecular localization of human IgG anti-F(ab')2 reactivity with variable- and constant-region lambda light-chain epitopes.

    ID: 1770280

    Description: epitope description:GASVKVT antigen name:Immunoglobulin host organism:Homo sapiens

    Publication: 8576321;

  54. Molecular localization of human IgG anti-F(ab')2 reactivity with variable- and constant-region lambda light-chain epitopes.

    ID: 1770281

    Description: epitope description:ASVKVTC antigen name:Immunoglobulin host organism:Homo sapiens

    Publication: 8576321;

  55. Molecular localization of human IgG anti-F(ab')2 reactivity with variable- and constant-region lambda light-chain epitopes.

    ID: 1770285

    Description: epitope description:VTCTLSR antigen name:Immunoglobulin host organism:Homo sapiens

    Publication: 8576321;

  56. Molecular localization of human IgG anti-F(ab')2 reactivity with variable- and constant-region lambda light-chain epitopes.

    ID: 1770295

    Description: epitope description:SYAIAWH antigen name:Immunoglobulin host organism:Homo sapiens

    Publication: 8576321;

  57. Molecular localization of human IgG anti-F(ab')2 reactivity with variable- and constant-region lambda light-chain epitopes.

    ID: 1770302

    Description: epitope description:QQQPERG antigen name:Immunoglobulin host organism:Homo sapiens

    Publication: 8576321;

  58. Molecular localization of human IgG anti-F(ab')2 reactivity with variable- and constant-region lambda light-chain epitopes.

    ID: 1770303

    Description: epitope description:QQPERGL antigen name:Immunoglobulin host organism:Homo sapiens

    Publication: 8576321;

  59. Molecular localization of human IgG anti-F(ab')2 reactivity with variable- and constant-region lambda light-chain epitopes.

    ID: 1770316

    Description: epitope description:NSDGSHT antigen name:Immunoglobulin host organism:Homo sapiens

    Publication: 8576321;

  60. Molecular localization of human IgG anti-F(ab')2 reactivity with variable- and constant-region lambda light-chain epitopes.

    ID: 1770322

    Description: epitope description:TRGDAIP antigen name:Immunoglobulin host organism:Homo sapiens

    Publication: 8576321;

  61. Molecular localization of human IgG anti-F(ab')2 reactivity with variable- and constant-region lambda light-chain epitopes.

    ID: 1770331

    Description: epitope description:FSGSSSG antigen name:Immunoglobulin host organism:Homo sapiens

    Publication: 8576321;

  62. Molecular localization of human IgG anti-F(ab')2 reactivity with variable- and constant-region lambda light-chain epitopes.

    ID: 1770332

    Description: epitope description:SGSSSGT antigen name:Immunoglobulin host organism:Homo sapiens

    Publication: 8576321;

  63. Molecular localization of human IgG anti-F(ab')2 reactivity with variable- and constant-region lambda light-chain epitopes.

    ID: 1770335

    Description: epitope description:SSGTERI antigen name:Immunoglobulin host organism:Homo sapiens

    Publication: 8576321;

  64. Molecular localization of human IgG anti-F(ab')2 reactivity with variable- and constant-region lambda light-chain epitopes.

    ID: 1770343

    Description: epitope description:TISSLQS antigen name:Immunoglobulin host organism:Homo sapiens

    Publication: 8576321;

  65. Molecular localization of human IgG anti-F(ab')2 reactivity with variable- and constant-region lambda light-chain epitopes.

    ID: 1770345

    Description: epitope description:SSLQSED antigen name:Immunoglobulin host organism:Homo sapiens

    Publication: 8576321;

  66. Molecular localization of human IgG anti-F(ab')2 reactivity with variable- and constant-region lambda light-chain epitopes.

    ID: 1770349

    Description: epitope description:SEDEADY antigen name:Immunoglobulin host organism:Homo sapiens

    Publication: 8576321;

  67. Molecular localization of human IgG anti-F(ab')2 reactivity with variable- and constant-region lambda light-chain epitopes.

    ID: 1770350

    Description: epitope description:EDEADYY antigen name:Immunoglobulin host organism:Homo sapiens

    Publication: 8576321;

  68. Molecular localization of human IgG anti-F(ab')2 reactivity with variable- and constant-region lambda light-chain epitopes.

    ID: 1770351

    Description: epitope description:DEADYYC antigen name:Immunoglobulin host organism:Homo sapiens

    Publication: 8576321;

  69. Molecular localization of human IgG anti-F(ab')2 reactivity with variable- and constant-region lambda light-chain epitopes.

    ID: 1770353

    Description: epitope description:ADYYCQT antigen name:Immunoglobulin host organism:Homo sapiens

    Publication: 8576321;

  70. Molecular localization of human IgG anti-F(ab')2 reactivity with variable- and constant-region lambda light-chain epitopes.

    ID: 1770355

    Description: epitope description:YYCQTWG antigen name:Immunoglobulin host organism:Homo sapiens

    Publication: 8576321;

  71. Identification of major linear epitopes on the sp100 nuclear PBC autoantigen by the gene-fragment phage-display technology.

    ID: 1770369

    Description: epitope description:EGSTDVDEPLEVFISAPRSE antigen name:Nuclear autoantigen Sp-100 (UniProt:P23497) host organism:Homo sapiens

    Publication: 10052683;

  72. Identification of major linear epitopes on the sp100 nuclear PBC autoantigen by the gene-fragment phage-display technology.

    ID: 1770370

    Description: epitope description:SNSKVECQAQARTHH antigen name:Nuclear autoantigen Sp-100 (UniProt:P23497) host organism:Homo sapiens

    Publication: 10052683;

  73. Identification of major linear epitopes on the sp100 nuclear PBC autoantigen by the gene-fragment phage-display technology.

    ID: 1770374

    Description: epitope description:THHNQASDIIVISS antigen name:Nuclear autoantigen Sp-100 (UniProt:P23497) host organism:Homo sapiens

    Publication: 10052683;

  74. Identification of major linear epitopes on the sp100 nuclear PBC autoantigen by the gene-fragment phage-display technology.

    ID: 1770376

    Description: epitope description:SDIIVISSEDSEGST antigen name:Nuclear autoantigen Sp-100 (UniProt:P23497) host organism:Homo sapiens

    Publication: 10052683;

  75. Molecular localization of human IgG anti-F(ab')2 reactivity with variable- and constant-region lambda light-chain epitopes.

    ID: 1770384

    Description: epitope description:YLSLTPE antigen name:Immunoglobulin host organism:Mus musculus

    Publication: 8576321;

  76. Localization of the binding regions of a murine monoclonal anti-factor VIII antibody and a human anti-factor VIII alloantibody, both of which inhibit ...

    ID: 1770388

    Description: epitope description:TDSEMDVVRFDDDNS antigen name:Coagulation factor VIII host organism:Homo sapiens

    Publication: 2839543;

  77. Molecular localization of human IgG anti-F(ab')2 reactivity with variable- and constant-region lambda light-chain epitopes.

    ID: 1770394

    Description: epitope description:PDRFSGS antigen name:Immunoglobulin host organism:Mus musculus

    Publication: 8576321;

  78. Molecular localization of human IgG anti-F(ab')2 reactivity with variable- and constant-region lambda light-chain epitopes.

    ID: 1770398

    Description: epitope description:YDSYAIA antigen name:Immunoglobulin host organism:Mus musculus

    Publication: 8576321;

  79. Molecular localization of human IgG anti-F(ab')2 reactivity with variable- and constant-region lambda light-chain epitopes.

    ID: 1770403

    Description: epitope description:PDRFSGS antigen name:Immunoglobulin host organism:Mus musculus

    Publication: 8576321;

  80. Molecular localization of human IgG anti-F(ab')2 reactivity with variable- and constant-region lambda light-chain epitopes.

    ID: 1770405

    Description: epitope description:YCQTWGS antigen name:Immunoglobulin host organism:Mus musculus

    Publication: 8576321;

  81. Molecular localization of human IgG anti-F(ab')2 reactivity with variable- and constant-region lambda light-chain epitopes.

    ID: 1770407

    Description: epitope description:SVKVTCT antigen name:Immunoglobulin host organism:Mus musculus

    Publication: 8576321;

  82. Molecular localization of human IgG anti-F(ab')2 reactivity with variable- and constant-region lambda light-chain epitopes.

    ID: 1770417

    Description: epitope description:DGSHTRG antigen name:Immunoglobulin host organism:Mus musculus

    Publication: 8576321;

  83. Molecular localization of human IgG anti-F(ab')2 reactivity with variable- and constant-region lambda light-chain epitopes.

    ID: 1770430

    Description: epitope description:ATLVCLI antigen name:Immunoglobulin host organism:Homo sapiens

    Publication: 8576321;

  84. Molecular localization of human IgG anti-F(ab')2 reactivity with variable- and constant-region lambda light-chain epitopes.

    ID: 1770435

    Description: epitope description:GASVKVT antigen name:Immunoglobulin host organism:Mus musculus

    Publication: 8576321;

  85. A potent erythropoietin-mimicking human antibody interacts through a novel binding site.

    ID: 1770476

    Description: epitope description:E49, L50, W88, E121, R123, P131, H134, R135, V136, H138 antigen name:Erythropoietin receptor host organism:Mus musculus Xenomouse ...

    Publication: 17620453;

  86. Epitope localization of monoclonal antibodies against factor VIII light chain which inhibit complex formation by factor VIII with von Willebrand facto...

    ID: 1770484

    Description: epitope description:EDFDIYDEDE antigen name:Coagulation factor VIII host organism:Mus musculus antibody name:NMC-VIII/10

    Publication: 1724391;

  87. Epitope localization of monoclonal antibodies against factor VIII light chain which inhibit complex formation by factor VIII with von Willebrand facto...

    ID: 1770485

    Description: epitope description:EDFDIYDEDE antigen name:Coagulation factor VIII host organism:Mus musculus antibody name:NMC-VIII/8, NMC-VIII/9, NMC-VIII/10

    Publication: 1724391;

  88. Broadly protective monoclonal antibodies against H3 influenza viruses following sequential immunization with different hemagglutinins.

    ID: 1770506

    Description: epitope description:RIQDLEKYVEDTKIDLWSYNAELLVALENQ antigen name:Hemagglutinin host organism:Mus musculus BALB/c antibody name:12D1

    Publication: 20195520;

  89. Broadly protective monoclonal antibodies against H3 influenza viruses following sequential immunization with different hemagglutinins.

    ID: 1770508

    Description: epitope description:RIQDLEKYVEDTKIDLWSYNAELLVALENQ antigen name:Hemagglutinin host organism:Mus musculus BALB/c antibody name:12D1

    Publication: 20195520;

  90. Structural basis for the preferential recognition of immature flaviviruses by a fusion-loop antibody.

    ID: 1770520

    Description: epitope description:C74, P75, T76, M77, G78, E79, G104, C105, G106, L107, G109, K110 antigen name:Genome polyprotein host organism:Mus musculus BALB/c...

    Publication: 19713934;

  91. Targeted antipeptide antibodies to cytochrome P450 2C18 based on epitope mapping of an inhibitory monoclonal antibody to P450 2C51.

    ID: 1770521

    Description: epitope description:QESLDMNSARDF antigen name:Cytochrome P450 2C18 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 9028867;

  92. Defining the major antibody epitopes on the human thyrotropin receptor in immunized mice: evidence for intramolecular epitope spreading.

    ID: 1764349

    Description: epitope description:RNLTYIDPDALKELPLLKFL antigen name:Thyrotropin receptor host organism:Mus musculus CBA/J

    Publication: 7664661;

  93. Defining the major antibody epitopes on the human thyrotropin receptor in immunized mice: evidence for intramolecular epitope spreading.

    ID: 1764354

    Description: epitope description:PDLTKVYSTDIFFILEITDN antigen name:Thyrotropin receptor host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7664661;

  94. Defining the major antibody epitopes on the human thyrotropin receptor in immunized mice: evidence for intramolecular epitope spreading.

    ID: 1764356

    Description: epitope description:EITDNPYMTSIPVNAFQGLC antigen name:Thyrotropin receptor host organism:Mus musculus CBA/J

    Publication: 7664661;

  95. Defining the major antibody epitopes on the human thyrotropin receptor in immunized mice: evidence for intramolecular epitope spreading.

    ID: 1764360

    Description: epitope description:FQGLCNETLTLKLYNNGFTS antigen name:Thyrotropin receptor host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7664661;

  96. Defining the major antibody epitopes on the human thyrotropin receptor in immunized mice: evidence for intramolecular epitope spreading.

    ID: 1764361

    Description: epitope description:FQGLCNETLTLKLYNNGFTS antigen name:Thyrotropin receptor host organism:Mus musculus CBA/J

    Publication: 7664661;

  97. Defining the major antibody epitopes on the human thyrotropin receptor in immunized mice: evidence for intramolecular epitope spreading.

    ID: 1764367

    Description: epitope description:LDAVYLNKNKYLTVIDKDAF antigen name:Thyrotropin receptor host organism:Mus musculus CBA/J

    Publication: 7664661;

  98. Defining the major antibody epitopes on the human thyrotropin receptor in immunized mice: evidence for intramolecular epitope spreading.

    ID: 1764371

    Description: epitope description:DVSQTSVTALPSKGLEHLKE antigen name:Thyrotropin receptor host organism:Mus musculus CBA/J

    Publication: 7664661;

  99. Defining the major antibody epitopes on the human thyrotropin receptor in immunized mice: evidence for intramolecular epitope spreading.

    ID: 1764378

    Description: epitope description:KLPLSLSFLHLTRADLSYPS antigen name:Thyrotropin receptor host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7664661;

  100. Defining the major antibody epitopes on the human thyrotropin receptor in immunized mice: evidence for intramolecular epitope spreading.

    ID: 1764382

    Description: epitope description:LSYPSHCCAFKNQKKIRGIL antigen name:Thyrotropin receptor host organism:Mus musculus CBA/J

    Publication: 7664661;
Displaying 100 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston