Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 100 of 1,510,353 results for " "

  1. Defining the major antibody epitopes on the human thyrotropin receptor in immunized mice: evidence for intramolecular epitope spreading.

    ID: 1764383

    Description: epitope description:IRGILESLMCNESSMQSLRQ antigen name:Thyrotropin receptor host organism:Mus musculus CBA/J

    Publication: 7664661;

  2. Defining the major antibody epitopes on the human thyrotropin receptor in immunized mice: evidence for intramolecular epitope spreading.

    ID: 1764389

    Description: epitope description:LHQEYEENLGDSIVGYKEKS antigen name:Thyrotropin receptor host organism:Mus musculus CBA/J

    Publication: 7664661;

  3. Defining the major antibody epitopes on the human thyrotropin receptor in immunized mice: evidence for intramolecular epitope spreading.

    ID: 1764395

    Description: epitope description:YYVFFEEQEDEIIGFGQELK antigen name:Thyrotropin receptor host organism:Mus musculus CBA/J

    Publication: 7664661;

  4. Defining the major antibody epitopes on the human thyrotropin receptor in immunized mice: evidence for intramolecular epitope spreading.

    ID: 1764398

    Description: epitope description:GQELKNPQEETLQAFDSHYD antigen name:Thyrotropin receptor host organism:Mus musculus CBA/J

    Publication: 7664661;

  5. Defining the major antibody epitopes on the human thyrotropin receptor in immunized mice: evidence for intramolecular epitope spreading.

    ID: 1764404

    Description: epitope description:VCTPKSDEFNPCEDIMGYK antigen name:Thyrotropin receptor host organism:Mus musculus CBA/J

    Publication: 7664661;

  6. Defining the major antibody epitopes on the human thyrotropin receptor in immunized mice: evidence for intramolecular epitope spreading.

    ID: 1764406

    Description: epitope description:VCTPKSDEFNPCEDIMGYK antigen name:Thyrotropin receptor host organism:Mus musculus CBA/J

    Publication: 7664661;

  7. Characterization of the human autoimmune response to the major C-terminal epitope of the ribosomal P proteins.

    ID: 1764417

    Description: epitope description:PKCFIVGADNVGSKQ antigen name:60S acidic ribosomal protein P0 (UniProt:P05388) host organism:Homo sapiens

    Publication: 12682728;

  8. Characterization of the human autoimmune response to the major C-terminal epitope of the ribosomal P proteins.

    ID: 1764420

    Description: epitope description:SKQMQQIRMSLRGKA antigen name:60S acidic ribosomal protein P0 (UniProt:P05388) host organism:Homo sapiens

    Publication: 12682728;

  9. Characterization of the human autoimmune response to the major C-terminal epitope of the ribosomal P proteins.

    ID: 1764427

    Description: epitope description:IRGHLENNPALEKLL antigen name:60S acidic ribosomal protein P0 (UniProt:P05388) host organism:Homo sapiens

    Publication: 12682728;

  10. Characterization of the human autoimmune response to the major C-terminal epitope of the ribosomal P proteins.

    ID: 1764435

    Description: epitope description:EIRDMLLANKVPAAA antigen name:60S acidic ribosomal protein P0 (UniProt:P05388) host organism:Homo sapiens

    Publication: 12682728;

  11. Characterization of the human autoimmune response to the major C-terminal epitope of the ribosomal P proteins.

    ID: 1764438

    Description: epitope description:AAARAGAIAPCEVTV antigen name:60S acidic ribosomal protein P0 (UniProt:P05388) host organism:Homo sapiens

    Publication: 12682728;

  12. Characterization of the human autoimmune response to the major C-terminal epitope of the ribosomal P proteins.

    ID: 1764441

    Description: epitope description:VTVPAQNTGLGPEKT antigen name:60S acidic ribosomal protein P0 (UniProt:P05388) host organism:Homo sapiens

    Publication: 12682728;

  13. Characterization of the human autoimmune response to the major C-terminal epitope of the ribosomal P proteins.

    ID: 1764442

    Description: epitope description:AQNTGLGPEKTSFFQ antigen name:60S acidic ribosomal protein P0 (UniProt:P05388) host organism:Homo sapiens

    Publication: 12682728;

  14. Characterization of the human autoimmune response to the major C-terminal epitope of the ribosomal P proteins.

    ID: 1764447

    Description: epitope description:TKISRGTIEILSDVQ antigen name:60S acidic ribosomal protein P0 (UniProt:P05388) host organism:Homo sapiens

    Publication: 12682728;

  15. Characterization of the human autoimmune response to the major C-terminal epitope of the ribosomal P proteins.

    ID: 1764474

    Description: epitope description:VETDYTFPLAEKVKA antigen name:60S acidic ribosomal protein P0 (UniProt:P05388) host organism:Homo sapiens

    Publication: 12682728;

  16. Characterization of the human autoimmune response to the major C-terminal epitope of the ribosomal P proteins.

    ID: 1764476

    Description: epitope description:LAEKVKAFLADPSAF antigen name:60S acidic ribosomal protein P0 (UniProt:P05388) host organism:Homo sapiens

    Publication: 12682728;

  17. Characterization of the human autoimmune response to the major C-terminal epitope of the ribosomal P proteins.

    ID: 1764479

    Description: epitope description:SAFVAAAPVAAATTA antigen name:60S acidic ribosomal protein P0 (UniProt:P05388) host organism:Homo sapiens

    Publication: 12682728;

  18. Characterization of the human autoimmune response to the major C-terminal epitope of the ribosomal P proteins.

    ID: 1764482

    Description: epitope description:TTAAPAAAAAPAKVE antigen name:60S acidic ribosomal protein P0 (UniProt:P05388) host organism:Homo sapiens

    Publication: 12682728;

  19. Characterization of the human autoimmune response to the major C-terminal epitope of the ribosomal P proteins.

    ID: 1764486

    Description: epitope description:KEESEESDEDMGFGL antigen name:60S acidic ribosomal protein P0 (UniProt:P05388) host organism:Homo sapiens

    Publication: 12682728;

  20. Characterization of the human autoimmune response to the major C-terminal epitope of the ribosomal P proteins.

    ID: 1764488

    Description: epitope description:MASVSELACIYSALI antigen name:60S acidic ribosomal protein P1 host organism:Homo sapiens

    Publication: 12682728;

  21. Characterization of the human autoimmune response to the major C-terminal epitope of the ribosomal P proteins.

    ID: 1764489

    Description: epitope description:SELACIYSALILHDD antigen name:60S acidic ribosomal protein P1 host organism:Homo sapiens

    Publication: 12682728;

  22. Characterization of the human autoimmune response to the major C-terminal epitope of the ribosomal P proteins.

    ID: 1764490

    Description: epitope description:CIYSALILHDDEVTV antigen name:60S acidic ribosomal protein P1 host organism:Homo sapiens

    Publication: 12682728;

  23. Characterization of the human autoimmune response to the major C-terminal epitope of the ribosomal P proteins.

    ID: 1764497

    Description: epitope description:VNVEPFWPGLFAKAL antigen name:60S acidic ribosomal protein P1 host organism:Homo sapiens

    Publication: 12682728;

  24. Characterization of the human autoimmune response to the major C-terminal epitope of the ribosomal P proteins.

    ID: 1764502

    Description: epitope description:GSLICNVGAGGPAPA antigen name:60S acidic ribosomal protein P1 host organism:Homo sapiens

    Publication: 12682728;

  25. Characterization of the human autoimmune response to the major C-terminal epitope of the ribosomal P proteins.

    ID: 1764505

    Description: epitope description:APAAGAAPAGGPAPS antigen name:60S acidic ribosomal protein P1 host organism:Homo sapiens

    Publication: 12682728;

  26. Characterization of the human autoimmune response to the major C-terminal epitope of the ribosomal P proteins.

    ID: 1764506

    Description: epitope description:GAAPAGGPAPSTAAA antigen name:60S acidic ribosomal protein P1 host organism:Homo sapiens

    Publication: 12682728;

  27. Characterization of the human autoimmune response to the major C-terminal epitope of the ribosomal P proteins.

    ID: 1764508

    Description: epitope description:APSTAAAPAEEKKVE antigen name:60S acidic ribosomal protein P1 host organism:Homo sapiens

    Publication: 12682728;

  28. Characterization of the human autoimmune response to the major C-terminal epitope of the ribosomal P proteins.

    ID: 1764511

    Description: epitope description:KVEAKKEESEESDDD antigen name:60S acidic ribosomal protein P1 host organism:Homo sapiens

    Publication: 12682728;

  29. Characterization of the human autoimmune response to the major C-terminal epitope of the ribosomal P proteins.

    ID: 1764516

    Description: epitope description:LAALGGNSSPSAKDI antigen name:60S acidic ribosomal protein P2 host organism:Homo sapiens

    Publication: 12682728;

  30. Characterization of the human autoimmune response to the major C-terminal epitope of the ribosomal P proteins.

    ID: 1764533

    Description: epitope description:PGSAAPAAGSAPAAA antigen name:60S acidic ribosomal protein P2 host organism:Homo sapiens

    Publication: 12682728;

  31. Characterization of the human autoimmune response to the major C-terminal epitope of the ribosomal P proteins.

    ID: 1764537

    Description: epitope description:EKKDEKKEESEESDD antigen name:60S acidic ribosomal protein P2 host organism:Homo sapiens

    Publication: 12682728;

  32. Characterization of the human autoimmune response to the major C-terminal epitope of the ribosomal P proteins.

    ID: 1764538

    Description: epitope description:EKKEESEESDDDMGF antigen name:60S acidic ribosomal protein P2 host organism:Homo sapiens

    Publication: 12682728;

  33. An altered immune response to Epstein-Barr nuclear antigen 1 in pediatric systemic lupus erythematosus.

    ID: 1764607

    Description: epitope description:GGAGAGGGAGAGG antigen name:Epstein-Barr nuclear antigen 1 host organism:Homo sapiens

    Publication: 16385527;

  34. An altered immune response to Epstein-Barr nuclear antigen 1 in pediatric systemic lupus erythematosus.

    ID: 1764615

    Description: epitope description:GGAGAGGGAGAGGGAG antigen name:Epstein-Barr nuclear antigen 1 host organism:Homo sapiens

    Publication: 16385527;

  35. An altered immune response to Epstein-Barr nuclear antigen 1 in pediatric systemic lupus erythematosus.

    ID: 1764619

    Description: epitope description:PPPGRRP antigen name:Epstein-Barr nuclear antigen 1 host organism:Homo sapiens

    Publication: 16385527;

  36. B cells from glatiramer acetate-treated mice suppress experimental autoimmune encephalomyelitis.

    ID: 1764623

    Description: epitope description:MEVGWYRSPFSRVVHLYRNGK antigen name:Myelin-oligodendrocyte glycoprotein host organism:Mus musculus C57BL/6

    Publication: 19879259;

  37. Differential humoral immune response against hepatitis C virus antigenic synthetic peptides in infected patients with and without mixed cryoglobulinae...

    ID: 1764629

    Description: epitope description:IIPDREVLYREFDEMEEC antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 8697636;

  38. Profile of the regions of acetylcholine receptor alpha chain recognized by T-lymphocytes and by antibodies in EAMG-susceptible and non-susceptible mou...

    ID: 1764654

    Description: epitope description:DLVLYNNADGDFAIVH antigen name:Acetylcholine receptor subunit alpha host organism:Mus musculus C57BL/6N

    Publication: 7519305;

  39. Comparative mapping of human thyrotropin, gonadotropins, and free subunits with antipeptide antibodies.

    ID: 1764681

    Description: epitope description:LQCMGCCFSRAYPTPLRSKKTMLVQK antigen name:Glycoprotein hormones alpha chain host organism:Oryctolagus cuniculus

    Publication: 1396343;

  40. Comparative mapping of human thyrotropin, gonadotropins, and free subunits with antipeptide antibodies.

    ID: 1764683

    Description: epitope description:CMTRDINGKLFLPKYALSQDV antigen name:Thyrotropin subunit beta host organism:Oryctolagus cuniculus

    Publication: 1396343;

  41. Comparative mapping of human thyrotropin, gonadotropins, and free subunits with antipeptide antibodies.

    ID: 1764684

    Description: epitope description:CMTRDINGKLFLPKYALSQDV antigen name:Thyrotropin subunit beta host organism:Oryctolagus cuniculus

    Publication: 1396343;

  42. Comparative mapping of human thyrotropin, gonadotropins, and free subunits with antipeptide antibodies.

    ID: 1764687

    Description: epitope description:CMTRDINGKLFLPKYALSQDV antigen name:Thyrotropin subunit beta host organism:Oryctolagus cuniculus

    Publication: 1396343;

  43. Early targets of nuclear RNP humoral autoimmunity in human systemic lupus erythematosus.

    ID: 1773898

    Description: epitope description:QAQSLIDKTT antigen name:U1 small nuclear ribonucleoprotein C host organism:Homo sapiens

    Publication: 19248110;

  44. Early targets of nuclear RNP humoral autoimmunity in human systemic lupus erythematosus.

    ID: 1773902

    Description: epitope description:TTAAFQQGKI antigen name:U1 small nuclear ribonucleoprotein C host organism:Homo sapiens

    Publication: 19248110;

  45. Early targets of nuclear RNP humoral autoimmunity in human systemic lupus erythematosus.

    ID: 1773911

    Description: epitope description:PPAGAMIPPP antigen name:U1 small nuclear ribonucleoprotein C host organism:Homo sapiens

    Publication: 19248110;

  46. Early targets of nuclear RNP humoral autoimmunity in human systemic lupus erythematosus.

    ID: 1773915

    Description: epitope description:PPPSLPGPPR antigen name:U1 small nuclear ribonucleoprotein C host organism:Homo sapiens

    Publication: 19248110;

  47. Early targets of nuclear RNP humoral autoimmunity in human systemic lupus erythematosus.

    ID: 1773922

    Description: epitope description:PAPHMGGPPM antigen name:U1 small nuclear ribonucleoprotein C host organism:Homo sapiens

    Publication: 19248110;

  48. Early targets of nuclear RNP humoral autoimmunity in human systemic lupus erythematosus.

    ID: 1773924

    Description: epitope description:MGGPPMMPMM antigen name:U1 small nuclear ribonucleoprotein C host organism:Homo sapiens

    Publication: 19248110;

  49. Early targets of nuclear RNP humoral autoimmunity in human systemic lupus erythematosus.

    ID: 1773926

    Description: epitope description:PMMPMMGPPP antigen name:U1 small nuclear ribonucleoprotein C host organism:Homo sapiens

    Publication: 19248110;

  50. Early targets of nuclear RNP humoral autoimmunity in human systemic lupus erythematosus.

    ID: 1773944

    Description: epitope description:PMMRPPARPM antigen name:U1 small nuclear ribonucleoprotein C host organism:Homo sapiens

    Publication: 19248110;

  51. Early targets of nuclear RNP humoral autoimmunity in human systemic lupus erythematosus.

    ID: 1773950

    Description: epitope description:PTRPGMTRPD antigen name:U1 small nuclear ribonucleoprotein C host organism:Homo sapiens

    Publication: 19248110;

  52. Early targets of nuclear RNP humoral autoimmunity in human systemic lupus erythematosus.

    ID: 1773952

    Description: epitope description:QFLPPNLLAL antigen name:U1 small nuclear ribonucleoprotein 70 kDa host organism:Homo sapiens

    Publication: 19248110;

  53. Early targets of nuclear RNP humoral autoimmunity in human systemic lupus erythematosus.

    ID: 1773953

    Description: epitope description:LPPNLLALFA antigen name:U1 small nuclear ribonucleoprotein 70 kDa host organism:Homo sapiens

    Publication: 19248110;

  54. Early targets of nuclear RNP humoral autoimmunity in human systemic lupus erythematosus.

    ID: 1773956

    Description: epitope description:ALFAPRDPIP antigen name:U1 small nuclear ribonucleoprotein 70 kDa host organism:Homo sapiens

    Publication: 19248110;

  55. Early targets of nuclear RNP humoral autoimmunity in human systemic lupus erythematosus.

    ID: 1773964

    Description: epitope description:KLPHEKHHNQ antigen name:U1 small nuclear ribonucleoprotein 70 kDa host organism:Homo sapiens

    Publication: 19248110;

  56. Early targets of nuclear RNP humoral autoimmunity in human systemic lupus erythematosus.

    ID: 1773981

    Description: epitope description:ETREERMERK antigen name:U1 small nuclear ribonucleoprotein 70 kDa host organism:Homo sapiens

    Publication: 19248110;

  57. Early targets of nuclear RNP humoral autoimmunity in human systemic lupus erythematosus.

    ID: 1773983

    Description: epitope description:ERMERKRREK antigen name:U1 small nuclear ribonucleoprotein 70 kDa host organism:Homo sapiens

    Publication: 19248110;

  58. Early targets of nuclear RNP humoral autoimmunity in human systemic lupus erythematosus.

    ID: 1773986

    Description: epitope description:RREKIERRQQ antigen name:U1 small nuclear ribonucleoprotein 70 kDa host organism:Homo sapiens

    Publication: 19248110;

  59. Early targets of nuclear RNP humoral autoimmunity in human systemic lupus erythematosus.

    ID: 1773988

    Description: epitope description:IERRQQEVET antigen name:U1 small nuclear ribonucleoprotein 70 kDa host organism:Homo sapiens

    Publication: 19248110;

  60. Early targets of nuclear RNP humoral autoimmunity in human systemic lupus erythematosus.

    ID: 1773990

    Description: epitope description:QQEVETELKM antigen name:U1 small nuclear ribonucleoprotein 70 kDa host organism:Homo sapiens

    Publication: 19248110;

  61. Early targets of nuclear RNP humoral autoimmunity in human systemic lupus erythematosus.

    ID: 1773994

    Description: epitope description:KMWDPHNDPN antigen name:U1 small nuclear ribonucleoprotein 70 kDa host organism:Homo sapiens

    Publication: 19248110;

  62. Early targets of nuclear RNP humoral autoimmunity in human systemic lupus erythematosus.

    ID: 1774001

    Description: epitope description:AFKTLFVARV antigen name:U1 small nuclear ribonucleoprotein 70 kDa host organism:Homo sapiens

    Publication: 19248110;

  63. Early targets of nuclear RNP humoral autoimmunity in human systemic lupus erythematosus.

    ID: 1774008

    Description: epitope description:TESKLRREFE antigen name:U1 small nuclear ribonucleoprotein 70 kDa host organism:Homo sapiens

    Publication: 19248110;

  64. Early targets of nuclear RNP humoral autoimmunity in human systemic lupus erythematosus.

    ID: 1774014

    Description: epitope description:GPIKRIHMVY antigen name:U1 small nuclear ribonucleoprotein 70 kDa host organism:Homo sapiens

    Publication: 19248110;

  65. Early targets of nuclear RNP humoral autoimmunity in human systemic lupus erythematosus.

    ID: 1774015

    Description: epitope description:IKRIHMVYSK antigen name:U1 small nuclear ribonucleoprotein 70 kDa host organism:Homo sapiens

    Publication: 19248110;

  66. Early targets of nuclear RNP humoral autoimmunity in human systemic lupus erythematosus.

    ID: 1774026

    Description: epitope description:YEHERDMHSA antigen name:U1 small nuclear ribonucleoprotein 70 kDa host organism:Homo sapiens

    Publication: 19248110;

  67. Early targets of nuclear RNP humoral autoimmunity in human systemic lupus erythematosus.

    ID: 1774028

    Description: epitope description:RDMHSAYKHA antigen name:U1 small nuclear ribonucleoprotein 70 kDa host organism:Homo sapiens

    Publication: 19248110;

  68. Early targets of nuclear RNP humoral autoimmunity in human systemic lupus erythematosus.

    ID: 1774031

    Description: epitope description:YKHADGKKID antigen name:U1 small nuclear ribonucleoprotein 70 kDa host organism:Homo sapiens

    Publication: 19248110;

  69. Early targets of nuclear RNP humoral autoimmunity in human systemic lupus erythematosus.

    ID: 1774038

    Description: epitope description:LVDVERGRTV antigen name:U1 small nuclear ribonucleoprotein 70 kDa host organism:Homo sapiens

    Publication: 19248110;

  70. Early targets of nuclear RNP humoral autoimmunity in human systemic lupus erythematosus.

    ID: 1774055

    Description: epitope description:RHSGRDDTSR antigen name:U1 small nuclear ribonucleoprotein 70 kDa host organism:Homo sapiens

    Publication: 19248110;

  71. Early targets of nuclear RNP humoral autoimmunity in human systemic lupus erythematosus.

    ID: 1774057

    Description: epitope description:RDDTSRYDER antigen name:U1 small nuclear ribonucleoprotein 70 kDa host organism:Homo sapiens

    Publication: 19248110;

  72. Early targets of nuclear RNP humoral autoimmunity in human systemic lupus erythematosus.

    ID: 1774068

    Description: epitope description:RDRERERRER antigen name:U1 small nuclear ribonucleoprotein 70 kDa host organism:Homo sapiens

    Publication: 19248110;

  73. Early targets of nuclear RNP humoral autoimmunity in human systemic lupus erythematosus.

    ID: 1774080

    Description: epitope description:SRDRRRRSRS antigen name:U1 small nuclear ribonucleoprotein 70 kDa host organism:Homo sapiens

    Publication: 19248110;

  74. Early targets of nuclear RNP humoral autoimmunity in human systemic lupus erythematosus.

    ID: 1774085

    Description: epitope description:RDKEERRRSR antigen name:U1 small nuclear ribonucleoprotein 70 kDa host organism:Homo sapiens

    Publication: 19248110;

  75. Early targets of nuclear RNP humoral autoimmunity in human systemic lupus erythematosus.

    ID: 1774086

    Description: epitope description:KEERRRSRER antigen name:U1 small nuclear ribonucleoprotein 70 kDa host organism:Homo sapiens

    Publication: 19248110;

  76. Early targets of nuclear RNP humoral autoimmunity in human systemic lupus erythematosus.

    ID: 1774090

    Description: epitope description:ERSKDKDRDR antigen name:U1 small nuclear ribonucleoprotein 70 kDa host organism:Homo sapiens

    Publication: 19248110;

  77. Early targets of nuclear RNP humoral autoimmunity in human systemic lupus erythematosus.

    ID: 1774097

    Description: epitope description:SRSRERARRE antigen name:U1 small nuclear ribonucleoprotein 70 kDa host organism:Homo sapiens

    Publication: 19248110;

  78. Early targets of nuclear RNP humoral autoimmunity in human systemic lupus erythematosus.

    ID: 1774103

    Description: epitope description:RKEELRGGGG antigen name:U1 small nuclear ribonucleoprotein 70 kDa host organism:Homo sapiens

    Publication: 19248110;

  79. Early targets of nuclear RNP humoral autoimmunity in human systemic lupus erythematosus.

    ID: 1774107

    Description: epitope description:GGDMAEPSEA antigen name:U1 small nuclear ribonucleoprotein 70 kDa host organism:Homo sapiens

    Publication: 19248110;

  80. Early targets of nuclear RNP humoral autoimmunity in human systemic lupus erythematosus.

    ID: 1774108

    Description: epitope description:DMAEPSEAGD antigen name:U1 small nuclear ribonucleoprotein 70 kDa host organism:Homo sapiens

    Publication: 19248110;

  81. Early targets of nuclear RNP humoral autoimmunity in human systemic lupus erythematosus.

    ID: 1774109

    Description: epitope description:AEPSEAGDAP antigen name:U1 small nuclear ribonucleoprotein 70 kDa host organism:Homo sapiens

    Publication: 19248110;

  82. Early targets of nuclear RNP humoral autoimmunity in human systemic lupus erythematosus.

    ID: 1774123

    Description: epitope description:EKGRDRDRER antigen name:U1 small nuclear ribonucleoprotein 70 kDa host organism:Homo sapiens

    Publication: 19248110;

  83. Early targets of nuclear RNP humoral autoimmunity in human systemic lupus erythematosus.

    ID: 1774125

    Description: epitope description:DRDRERRRSH antigen name:U1 small nuclear ribonucleoprotein 70 kDa host organism:Homo sapiens

    Publication: 19248110;

  84. Early targets of nuclear RNP humoral autoimmunity in human systemic lupus erythematosus.

    ID: 1774130

    Description: epitope description:RSERERRRDR antigen name:U1 small nuclear ribonucleoprotein 70 kDa host organism:Homo sapiens

    Publication: 19248110;

  85. Early targets of nuclear RNP humoral autoimmunity in human systemic lupus erythematosus.

    ID: 1774131

    Description: epitope description:ERERRRDRDR antigen name:U1 small nuclear ribonucleoprotein 70 kDa host organism:Homo sapiens

    Publication: 19248110;

  86. Early targets of nuclear RNP humoral autoimmunity in human systemic lupus erythematosus.

    ID: 1774132

    Description: epitope description:ERRRDRDRDR antigen name:U1 small nuclear ribonucleoprotein 70 kDa host organism:Homo sapiens

    Publication: 19248110;

  87. Early targets of nuclear RNP humoral autoimmunity in human systemic lupus erythematosus.

    ID: 1774136

    Description: epitope description:DRDRDREHKR antigen name:U1 small nuclear ribonucleoprotein 70 kDa host organism:Homo sapiens

    Publication: 19248110;

  88. Early targets of nuclear RNP humoral autoimmunity in human systemic lupus erythematosus.

    ID: 1774146

    Description: epitope description:EARGGGGGQD antigen name:U1 small nuclear ribonucleoprotein 70 kDa host organism:Homo sapiens

    Publication: 19248110;

  89. Early targets of nuclear RNP humoral autoimmunity in human systemic lupus erythematosus.

    ID: 1774150

    Description: epitope description:QDNGLEGLGN antigen name:U1 small nuclear ribonucleoprotein 70 kDa host organism:Homo sapiens

    Publication: 19248110;

  90. Early targets of nuclear RNP humoral autoimmunity in human systemic lupus erythematosus.

    ID: 1774154

    Description: epitope description:GNDSRDMYME antigen name:U1 small nuclear ribonucleoprotein 70 kDa host organism:Homo sapiens

    Publication: 19248110;

  91. Early targets of nuclear RNP humoral autoimmunity in human systemic lupus erythematosus.

    ID: 1774161

    Description: epitope description:DGYLAPENGY antigen name:U1 small nuclear ribonucleoprotein 70 kDa host organism:Homo sapiens

    Publication: 19248110;

  92. Identification of a novel antibody associated with autoimmune pancreatitis.

    ID: 1774167

    Description: epitope description:AKEERRY antigen name:Plasminogen-binding protein PgbA host organism:Homo sapiens

    Publication: 19940298;

  93. Identification of a novel antibody associated with autoimmune pancreatitis.

    ID: 1774190

    Description: epitope description:AKEERRY antigen name:Plasminogen-binding protein PgbA host organism:Homo sapiens

    Publication: 19940298;

  94. Identification and characterization of epitopes recognized by T lymphocytes and autoantibodies from patients with herpes gestationis.

    ID: 1774191

    Description: epitope description:EEVRKLKARVDELERIR antigen name:Collagen alpha-1(XVII) chain host organism:Homo sapiens

    Publication: 10202047;

  95. Immunodominant epitopes of alpha3(IV)NC1 induce autoimmune glomerulonephritis in rats.

    ID: 1774223

    Description: epitope description:PGLKGKRGDSGSPATWTTRGFVFTRHSQTTAIPSCPEGTVPLYS antigen name:Collagen alpha-3(IV) chain host organism:Rattus norvegicus Wistar Kyoto

    Publication: 14633133;

  96. Immunodominant epitopes of alpha3(IV)NC1 induce autoimmune glomerulonephritis in rats.

    ID: 1774230

    Description: epitope description:TDIPPCPHGWISLWKGFSFIMFTSAGSEGTGQALASP antigen name:Collagen alpha-3(IV) chain host organism:Rattus norvegicus Wistar Kyoto

    Publication: 14633133;

  97. Co-administration of a CpG adjuvant (VaxImmune, CPG 7909) with CETP vaccines increased immunogenicity in rabbits and mice.

    ID: 1774260

    Description: epitope description:FGFPEHLLVDFLQSLS antigen name:Cholesteryl ester transfer protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 18670196;

  98. Broadly protective monoclonal antibodies against H3 influenza viruses following sequential immunization with different hemagglutinins.

    ID: 1774274

    Description: epitope description:RIQDLEKYVEDTKIDLWSYNAELLVALENQ antigen name:Hemagglutinin host organism:Mus musculus BALB/c antibody name:12D1

    Publication: 20195520;

  99. Neutralization of NGF-TrkA receptor interaction by the novel antagonistic anti-TrkA monoclonal antibody MNAC13: a structural insight.

    ID: 1774290

    Description: epitope description:AGWILTELEQSATVMKS antigen name:High affinity nerve growth factor receptor host organism:Mus musculus BALB/c antibody name:NMAC13

    Publication: 15625712;

  100. Juvenile hormone binding protein and transferrin from Galleria mellonella share a similar structural motif.

    ID: 1774303

    Description: epitope description:RDTKAVN antigen name:Juvenile hormone binding protein host organism:Mus musculus BALB/c antibody name:mAb 104

    Publication: 11530933;
Displaying 100 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston