In vivo induction of tolerance by an Ig peptide is not affected by the deletion of FcR or a mutated IgG Fc fragment.

ID: 1774308

Description: epitope description:LEDARRLKAIYEKKK antigen name:Other Escherichia coli protein host organism:Mus musculus BALB/c

A single-domain llama antibody potently inhibits the enzymatic activity of botulinum neurotoxin by binding to the non-catalytic alpha-exosite binding ...

ID: 1774310

Description: epitope description:D102, R105, M106, R113, K340, I348, N353, K356, F357 antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Lama ...

A single-domain llama antibody potently inhibits the enzymatic activity of botulinum neurotoxin by binding to the non-catalytic alpha-exosite binding ...

ID: 1774314

Description: epitope description:D102, R105, M106, R113, K340, I348, N353, K356, F357 antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Lama ...

A single-domain llama antibody potently inhibits the enzymatic activity of botulinum neurotoxin by binding to the non-catalytic alpha-exosite binding ...

ID: 1774317

Description: epitope description:D102, R105, M106, R113, K340, I348, N353, K356, F357 antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Lama ...

Analysis of samples from patients treated with ReFacto for the presence of anti-SQ-peptide specific antibodies.

ID: 1774326

Description: epitope description:NNAIEPRSFSQNPPV antigen name:Coagulation factor VIII host organism:Mus musculus

Analysis of samples from patients treated with ReFacto for the presence of anti-SQ-peptide specific antibodies.

ID: 1774329

Description: epitope description:RSFSQNPPVLKRHQR antigen name:Coagulation factor VIII host organism:Mus musculus

Analysis of samples from patients treated with ReFacto for the presence of anti-SQ-peptide specific antibodies.

ID: 1774330

Description: epitope description:FSQNPPVLKRHQR antigen name:Coagulation factor VIII host organism:Mus musculus

Analysis of samples from patients treated with ReFacto for the presence of anti-SQ-peptide specific antibodies.

ID: 1774344

Description: epitope description:IEPRSFSQNPPVLKR antigen name:Coagulation factor VIII host organism:Mus musculus antibody name:AU4F5, BZ1A2, AU1F5

Analysis of samples from patients treated with ReFacto for the presence of anti-SQ-peptide specific antibodies.

ID: 1774390

Description: epitope description:RSFSQNPPVLKRHQR antigen name:Coagulation factor VIII host organism:Homo sapiens

Mapping of melanin-concentrating hormone receptor 1 B cell epitopes predicts two major binding sites for vitiligo patient autoantibodies.

ID: 1774408

Description: epitope description:GCGIRLPNPDTDLYWFTLYQFFLA antigen name:Melanin-concentrating hormone receptor 1 (UniProt:Q99705) host organism:Homo sapiens

Mapping of melanin-concentrating hormone receptor 1 B cell epitopes predicts two major binding sites for vitiligo patient autoantibodies.

ID: 1774411

Description: epitope description:LYWFTLYQFFLA antigen name:Melanin-concentrating hormone receptor 1 (UniProt:Q99705) host organism:Homo sapiens

Mapping of melanin-concentrating hormone receptor 1 B cell epitopes predicts two major binding sites for vitiligo patient autoantibodies.

ID: 1774412

Description: epitope description:GSISYINIIMPSVFGTIC antigen name:Melanin-concentrating hormone receptor 1 (UniProt:Q99705) host organism:Homo sapiens

Mapping of melanin-concentrating hormone receptor 1 B cell epitopes predicts two major binding sites for vitiligo patient autoantibodies.

ID: 1774451

Description: epitope description:GNGVWHFGETMCTLITAMDANSQF antigen name:Melanin-concentrating hormone receptor 1 (UniProt:Q99705) host organism:Homo sapiens

Mapping of melanin-concentrating hormone receptor 1 B cell epitopes predicts two major binding sites for vitiligo patient autoantibodies.

ID: 1774454

Description: epitope description:GSISYINIIMPSVFGTIC antigen name:Melanin-concentrating hormone receptor 1 (UniProt:Q99705) host organism:Homo sapiens

Protective and heart-crossreactive epitopes located within the NH2 terminus of type 19 streptococcal M protein.

ID: 1774556

Description: epitope description:VRYSRESPEDKLKKIIDDLDAKEN antigen name:UniProt:A2RGM0 host organism:Oryctolagus cuniculus New Zealand White

The goodpasture autoantigen. Mapping the major conformational epitope(s) of alpha3(IV) collagen to residues 17-31 and 127-141 of the NC1 domain.

ID: 1774562

Description: epitope description:EKIISRCQVCMKKRH antigen name:Collagen alpha-3(IV) chain host organism:Homo sapiens

The goodpasture autoantigen. Mapping the major conformational epitope(s) of alpha3(IV) collagen to residues 17-31 and 127-141 of the NC1 domain.

ID: 1774563

Description: epitope description:LMPMNMAPITGRALE antigen name:Collagen alpha-3(IV) chain host organism:Homo sapiens

Nonobese diabetic mice display elevated levels of class II-associated invariant chain peptide associated with I-Ag7 on the cell surface.

ID: 1774570

Description: epitope description:RMATPLLMRPMSM antigen name:H-2 class II histocompatibility antigen gamma chain host organism:Oryctolagus cuniculus

Recombinant human antibodies against aldehyde-modified apolipoprotein B-100 peptide sequences inhibit atherosclerosis.

ID: 1774575

Description: epitope description:IEIGLEGKGFEPTLEALFGK antigen name:Apolipoprotein B-100 host organism:Homo sapiens antibody name:IEI-A8, IEI-G8, IEI-E3, IEI-D8

Two human neonatal IgM antibodies encoded by different variable-region genes bind the same linear peptide: evidence for a stereotyped repertoire of ep...

ID: 1774620

Description: epitope description:FGSNVHF host organism:Homo sapiens antibody name:mAbRWL1

Two human neonatal IgM antibodies encoded by different variable-region genes bind the same linear peptide: evidence for a stereotyped repertoire of ep...

ID: 1774631

Description: epitope description:WGSNNQN host organism:Homo sapiens antibody name:mAbRWL1

Two human neonatal IgM antibodies encoded by different variable-region genes bind the same linear peptide: evidence for a stereotyped repertoire of ep...

ID: 1774633

Description: epitope description:WGANVPS host organism:Homo sapiens antibody name:mAbRWL1

Two human neonatal IgM antibodies encoded by different variable-region genes bind the same linear peptide: evidence for a stereotyped repertoire of ep...

ID: 1774634

Description: epitope description:FGENNNM host organism:Homo sapiens antibody name:mAbRWL1

Two human neonatal IgM antibodies encoded by different variable-region genes bind the same linear peptide: evidence for a stereotyped repertoire of ep...

ID: 1774637

Description: epitope description:PRSENGV host organism:Homo sapiens antibody name:mAbRWL1

Two human neonatal IgM antibodies encoded by different variable-region genes bind the same linear peptide: evidence for a stereotyped repertoire of ep...

ID: 1774646

Description: epitope description:WGSNPAM host organism:Homo sapiens antibody name:mAbRWL2

Two human neonatal IgM antibodies encoded by different variable-region genes bind the same linear peptide: evidence for a stereotyped repertoire of ep...

ID: 1774647

Description: epitope description:FGENRPA host organism:Homo sapiens antibody name:mAbRWL1 and mAbRWL2

Two human neonatal IgM antibodies encoded by different variable-region genes bind the same linear peptide: evidence for a stereotyped repertoire of ep...

ID: 1774650

Description: epitope description:WGANTNL host organism:Homo sapiens antibody name:mAbRWL2

Two human neonatal IgM antibodies encoded by different variable-region genes bind the same linear peptide: evidence for a stereotyped repertoire of ep...

ID: 1774654

Description: epitope description:SVHMPVWGQNTS host organism:Homo sapiens antibody name:mAbRWL1 and mAbRWL2

Recombinant human antibodies against aldehyde-modified apolipoprotein B-100 peptide sequences inhibit atherosclerosis.

ID: 1774667

Description: epitope description:KTTKQSFDLSVKAQYKKNKH antigen name:Apolipoprotein B-100 host organism:Homo sapiens antibody name:KTT-D6, KTT-D8

Two human neonatal IgM antibodies encoded by different variable-region genes bind the same linear peptide: evidence for a stereotyped repertoire of ep...

ID: 1774702

Description: epitope description:PRIQSTYNNEGW host organism:Homo sapiens antibody name:mAbRWL1 + mAbRWL1

Epitope mapping of anti-troponin I monoclonal antibodies.

ID: 1774778

Description: epitope description:AKKK antigen name:Troponin I, cardiac muscle host organism:Mus musculus BALB/c antibody name:10F4

Epitope mapping of anti-troponin I monoclonal antibodies.

ID: 1774781

Description: epitope description:LGFAE antigen name:Troponin I, cardiac muscle host organism:Mus musculus BALB/c antibody name:2A3, 8E10, 16A11

Epitope mapping of anti-troponin I monoclonal antibodies.

ID: 1774783

Description: epitope description:DWRKNID antigen name:Troponin I, cardiac muscle host organism:Mus musculus BALB/c antibody name:7C5

Epitope mapping of anti-troponin I monoclonal antibodies.

ID: 1774786

Description: epitope description:RRSSN antigen name:Troponin I, cardiac muscle host organism:Mus musculus BALB/c antibody name:9H10, 16F1, 22B11, 10G4

Heat shock proteins and experimental autoimmune encephalomyelitis (EAE): I. Immunization with a peptide of the myelin protein 2',3' cyclic nucleotide ...

ID: 1774848

Description: epitope description:LKKLKPGLEKDF antigen name:Other Rattus norvegicus (rat) protein host organism:Rattus norvegicus Lewis

Comprehensive mapping of immunodominant and conserved serotype- and group-specific B-cell epitopes of nonstructural protein 1 from dengue virus type 1...

ID: 1774854

Description: epitope description:DSGCVINWKGRELKC antigen name:Genome polyprotein host organism:Mus musculus BALB/c

Comprehensive mapping of immunodominant and conserved serotype- and group-specific B-cell epitopes of nonstructural protein 1 from dengue virus type 1...

ID: 1774865

Description: epitope description:VTNEVHTWTEQYKFQ antigen name:Genome polyprotein host organism:Mus musculus BALB/c

Comprehensive mapping of immunodominant and conserved serotype- and group-specific B-cell epitopes of nonstructural protein 1 from dengue virus type 1...

ID: 1774872

Description: epitope description:RLSAAIGKAWEEGVC antigen name:Genome polyprotein host organism:Mus musculus BALB/c

Comprehensive mapping of immunodominant and conserved serotype- and group-specific B-cell epitopes of nonstructural protein 1 from dengue virus type 1...

ID: 1774884

Description: epitope description:ISNELNHILLENDMK antigen name:Genome polyprotein host organism:Mus musculus BALB/c

Comprehensive mapping of immunodominant and conserved serotype- and group-specific B-cell epitopes of nonstructural protein 1 from dengue virus type 1...

ID: 1774885

Description: epitope description:ISNELNHILLENDMK antigen name:Genome polyprotein host organism:Mus musculus BALB/c

Comprehensive mapping of immunodominant and conserved serotype- and group-specific B-cell epitopes of nonstructural protein 1 from dengue virus type 1...

ID: 1774887

Description: epitope description:ENDMKFTVVVGDVSG antigen name:Genome polyprotein host organism:Mus musculus BALB/c

Comprehensive mapping of immunodominant and conserved serotype- and group-specific B-cell epitopes of nonstructural protein 1 from dengue virus type 1...

ID: 1774889

Description: epitope description:ENDMKFTVVVGDVSG antigen name:Genome polyprotein host organism:Mus musculus BALB/c

Comprehensive mapping of immunodominant and conserved serotype- and group-specific B-cell epitopes of nonstructural protein 1 from dengue virus type 1...

ID: 1774890

Description: epitope description:GDVSGILTQGRKMIG antigen name:Genome polyprotein host organism:Mus musculus BALB/c

Comprehensive mapping of immunodominant and conserved serotype- and group-specific B-cell epitopes of nonstructural protein 1 from dengue virus type 1...

ID: 1774892

Description: epitope description:GDVSGILTQGRKMIG antigen name:Genome polyprotein host organism:Mus musculus BALB/c

Comprehensive mapping of immunodominant and conserved serotype- and group-specific B-cell epitopes of nonstructural protein 1 from dengue virus type 1...

ID: 1774895

Description: epitope description:RKMIGPQPMEHKYSW antigen name:Genome polyprotein host organism:Mus musculus BALB/c

Comprehensive mapping of immunodominant and conserved serotype- and group-specific B-cell epitopes of nonstructural protein 1 from dengue virus type 1...

ID: 1774911

Description: epitope description:PECPDDQRAWNIWEV antigen name:Genome polyprotein host organism:Mus musculus BALB/c

Comprehensive mapping of immunodominant and conserved serotype- and group-specific B-cell epitopes of nonstructural protein 1 from dengue virus type 1...

ID: 1774912

Description: epitope description:PECPDDQRAWNIWEV antigen name:Genome polyprotein host organism:Mus musculus BALB/c

Comprehensive mapping of immunodominant and conserved serotype- and group-specific B-cell epitopes of nonstructural protein 1 from dengue virus type 1...

ID: 1774917

Description: epitope description:NIWEVEDYGFGIFTT antigen name:Genome polyprotein host organism:Mus musculus BALB/c

Comprehensive mapping of immunodominant and conserved serotype- and group-specific B-cell epitopes of nonstructural protein 1 from dengue virus type 1...

ID: 1774918

Description: epitope description:GIFTTNIWLKLRDSY antigen name:Genome polyprotein host organism:Mus musculus BALB/c

Comprehensive mapping of immunodominant and conserved serotype- and group-specific B-cell epitopes of nonstructural protein 1 from dengue virus type 1...

ID: 1774923

Description: epitope description:LRDSYTQVCDPRLMS antigen name:Genome polyprotein host organism:Mus musculus BALB/c

Comprehensive mapping of immunodominant and conserved serotype- and group-specific B-cell epitopes of nonstructural protein 1 from dengue virus type 1...

ID: 1774925

Description: epitope description:LRDSYTQVCDPRLMS antigen name:Genome polyprotein host organism:Mus musculus BALB/c

Comprehensive mapping of immunodominant and conserved serotype- and group-specific B-cell epitopes of nonstructural protein 1 from dengue virus type 1...

ID: 1774927

Description: epitope description:PRLMSAAIKDSKAVH antigen name:Genome polyprotein host organism:Mus musculus BALB/c

Comprehensive mapping of immunodominant and conserved serotype- and group-specific B-cell epitopes of nonstructural protein 1 from dengue virus type 1...

ID: 1774934

Description: epitope description:WIESEKNETWKLARA antigen name:Genome polyprotein host organism:Mus musculus BALB/c

Comprehensive mapping of immunodominant and conserved serotype- and group-specific B-cell epitopes of nonstructural protein 1 from dengue virus type 1...

ID: 1774937

Description: epitope description:WIESEKNETWKLARA antigen name:Genome polyprotein host organism:Mus musculus BALB/c

Comprehensive mapping of immunodominant and conserved serotype- and group-specific B-cell epitopes of nonstructural protein 1 from dengue virus type 1...

ID: 1774939

Description: epitope description:KLARASFIEVKTCVW antigen name:Genome polyprotein host organism:Mus musculus BALB/c

Comprehensive mapping of immunodominant and conserved serotype- and group-specific B-cell epitopes of nonstructural protein 1 from dengue virus type 1...

ID: 1774945

Description: epitope description:KTCVWPKSHTLWSNG antigen name:Genome polyprotein host organism:Mus musculus BALB/c

Comprehensive mapping of immunodominant and conserved serotype- and group-specific B-cell epitopes of nonstructural protein 1 from dengue virus type 1...

ID: 1774946

Description: epitope description:LWSNGVLESEMIIPK antigen name:Genome polyprotein host organism:Mus musculus BALB/c

Comprehensive mapping of immunodominant and conserved serotype- and group-specific B-cell epitopes of nonstructural protein 1 from dengue virus type 1...

ID: 1774953

Description: epitope description:MIIPKIYGGPISQHN antigen name:Genome polyprotein host organism:Mus musculus BALB/c

Comprehensive mapping of immunodominant and conserved serotype- and group-specific B-cell epitopes of nonstructural protein 1 from dengue virus type 1...

ID: 1774957

Description: epitope description:ISQHNYRPGYSTQTA antigen name:Genome polyprotein host organism:Mus musculus BALB/c

Beta 2-microglobulin-free HLA class I heavy chain epitope mimicry by monoclonal antibody HC-10-specific peptide.

ID: 1778643

Description: epitope description:AEPFYSWDRASR host organism:Mus musculus BALB/c antibody name:HC-10

Beta 2-microglobulin-free HLA class I heavy chain epitope mimicry by monoclonal antibody HC-10-specific peptide.

ID: 1778648

Description: epitope description:QEGPEYWDRNT antigen name:HLA class I histocompatibility antigen, B-7 alpha chain host organism:Mus musculus BALB/c antibody name:H...

Beta 2-microglobulin-free HLA class I heavy chain epitope mimicry by monoclonal antibody HC-10-specific peptide.

ID: 1778649

Description: epitope description:EGPEYWDRET antigen name:HLA class I histocompatibility antigen, B-27 alpha chain host organism:Mus musculus BALB/c antibody name:H...

Beta 2-microglobulin-free HLA class I heavy chain epitope mimicry by monoclonal antibody HC-10-specific peptide.

ID: 1778650

Description: epitope description:EGPEYWDRET antigen name:HLA class I histocompatibility antigen, B-27 alpha chain host organism:Mus musculus BALB/c antibody name:H...

Assay for measurement of intact B-type natriuretic peptide prohormone in blood.

ID: 1778654

Description: epitope description:PRSPKM antigen name:Natriuretic peptides B host organism:Mus musculus BALB/c antibody name:Hinge76

Epitope specificity of anti-heat shock protein 65/60 serum antibodies in atherosclerosis.

ID: 1778682

Description: epitope description:ITVEESNT antigen name:60 kDa chaperonin 2 (UniProt:P9WPE7) host organism:Homo sapiens

Epitope specificity of anti-heat shock protein 65/60 serum antibodies in atherosclerosis.

ID: 1778684

Description: epitope description:VEESNTFG antigen name:60 kDa chaperonin 2 (UniProt:P9WPE7) host organism:Homo sapiens

The intracellular and extracellular domains of BP180 antigen comprise novel epitopes targeted by pemphigoid gestationis autoantibodies.

ID: 1778695

Description: epitope description:NSSPEYPRKEFASSSTRGRS antigen name:Collagen alpha-1(XVII) chain host organism:Homo sapiens

The intracellular and extracellular domains of BP180 antigen comprise novel epitopes targeted by pemphigoid gestationis autoantibodies.

ID: 1778698

Description: epitope description:LTWLLLLGLLFGLIALAEEVRKLKARVDELERIR antigen name:Collagen alpha-1(XVII) chain host organism:Homo sapiens

Design of antibody-reactive peptides from discontinuous parts of scorpion toxins.

ID: 1778711

Description: epitope description:YYYNETKLKESYKVKD host organism:Mus musculus C57BL/6

The intracellular and extracellular domains of BP180 antigen comprise novel epitopes targeted by pemphigoid gestationis autoantibodies.

ID: 1778721

Description: epitope description:GPVTTITGETFDYSELASHVVSYLRTSG antigen name:Collagen alpha-1(XVII) chain host organism:Homo sapiens

Characterization of FMRF amide-like immunoreactivity in rat spinal cord by region-specific antibodies in radioimmunoassay and HPLC.

ID: 1778749

Description: epitope description:YGGFMRF antigen name:Proenkephalin-A host organism:Oryctolagus cuniculus antibody name:S253

Characterization of FMRF amide-like immunoreactivity in rat spinal cord by region-specific antibodies in radioimmunoassay and HPLC.

ID: 1778757

Description: epitope description:RHRY antigen name:Pancreatic hormone host organism:Oryctolagus cuniculus antibody name:S253

Characterization of FMRF amide-like immunoreactivity in rat spinal cord by region-specific antibodies in radioimmunoassay and HPLC.

ID: 1778759

Description: epitope description:FMRF antigen name:Ambigolimax valentianus protein host organism:Oryctolagus cuniculus antibody name:S253

Antibody responses to mycobacterial and self heat shock protein 65 in autoimmune arthritis: epitope specificity and implication in pathogenesis.

ID: 1778782

Description: epitope description:MAKTIAYDEEARRGL antigen name:60 kDa chaperonin 2 (UniProt:P9WPE7) host organism:Rattus norvegicus Wistar Kyoto

Affects of N-terminal variation in the SeM protein of Streptococcus equi on antibody and fibrinogen binding.

ID: 1778784

Description: epitope description:YNLLMHLSSML antigen name:Antiphagocytic cell surface-anchored fibrinogen-and IgG Fc-binding protein SeM host organism:Mus musculus...

Antigenic structure of histone H2B.

ID: 1778801

Description: epitope description:PEPAKKVPAPK antigen name:Histone H2B type 1 host organism:Mus musculus MLR/lpr antibody name:73C3

Antigenic structure of histone H2B.

ID: 1778802

Description: epitope description:PEPAKKVPAPK antigen name:Histone H2B type 1 host organism:Mus musculus MLR/lpr antibody name:73C3

Antigenic structure of histone H2B.

ID: 1778807

Description: epitope description:GKKRKRSRKE antigen name:Histone H2B type 1 host organism:Mus musculus MLR/lpr antibody name:69B4

Molecular mapping of human band 3 aging antigenic sites and active amino acids using synthetic peptides.

ID: 1778818

Description: epitope description:NSSYFPGKL antigen name:Band 3 anion transport protein host organism:Homo sapiens

Molecular mapping of human band 3 aging antigenic sites and active amino acids using synthetic peptides.

ID: 1778824

Description: epitope description:GKASTPGAAAQIQEVKE antigen name:Band 3 anion transport protein host organism:Homo sapiens

Molecular mapping of human band 3 aging antigenic sites and active amino acids using synthetic peptides.

ID: 1778826

Description: epitope description:TSLSGIQ antigen name:Band 3 anion transport protein host organism:Homo sapiens

Molecular mapping of human band 3 aging antigenic sites and active amino acids using synthetic peptides.

ID: 1778827

Description: epitope description:QLFDRILL antigen name:Band 3 anion transport protein host organism:Homo sapiens

Molecular mapping of human band 3 aging antigenic sites and active amino acids using synthetic peptides.

ID: 1778831

Description: epitope description:RVKTWRMH antigen name:Band 3 anion transport protein host organism:Homo sapiens

Molecular mapping of human band 3 aging antigenic sites and active amino acids using synthetic peptides.

ID: 1778838

Description: epitope description:RNVELQ antigen name:Band 3 anion transport protein host organism:Homo sapiens

Molecular mapping of human band 3 aging antigenic sites and active amino acids using synthetic peptides.

ID: 1778848

Description: epitope description:AKLVTILQAHPLQQSYD antigen name:Band 3 anion transport protein host organism:Homo sapiens

What a polyclonal antibody sees in von Willebrand factor.

ID: 1778863

Description: epitope description:LCPPGMVRHENRCVALER antigen name:von Willebrand factor host organism:Oryctolagus cuniculus

Epitope mapping of inhibitory antibodies against platelet glycoprotein Ibalpha reveals interaction between the leucine-rich repeat N-terminal and C-te...

ID: 1778868

Description: epitope description:SDKFPVYKYPGKGCPTLGDEGDT host organism:Mus musculus antibody name:6B4

Epitope mapping of inhibitory antibodies against platelet glycoprotein Ibalpha reveals interaction between the leucine-rich repeat N-terminal and C-te...

ID: 1778870

Description: epitope description:EGLYSPWWPRSLPVL host organism:Mus musculus antibody name:6B4

Screening random peptide libraries with subacute sclerosing panencephalitis brain-derived recombinant antibodies identifies multiple epitopes in the C...

ID: 1778890

Description: epitope description:EKVTSTWTDWQY host organism:Homo sapiens antibody name:rAb 2B4

Screening random peptide libraries with subacute sclerosing panencephalitis brain-derived recombinant antibodies identifies multiple epitopes in the C...

ID: 1778901

Description: epitope description:HLNSLYYDWTEP host organism:Homo sapiens antibody name:rAb 2B4

Screening random peptide libraries with subacute sclerosing panencephalitis brain-derived recombinant antibodies identifies multiple epitopes in the C...

ID: 1778903

Description: epitope description:HPMYPTWYSWQP host organism:Homo sapiens antibody name:rAb 2B4

Screening random peptide libraries with subacute sclerosing panencephalitis brain-derived recombinant antibodies identifies multiple epitopes in the C...

ID: 1778906

Description: epitope description:SHNQLLRIQALD host organism:Homo sapiens antibody name:rAb 2B4

Screening random peptide libraries with subacute sclerosing panencephalitis brain-derived recombinant antibodies identifies multiple epitopes in the C...

ID: 1778910

Description: epitope description:NPWYNDLSLLTA host organism:Homo sapiens antibody name:rAb 3B

Screening random peptide libraries with subacute sclerosing panencephalitis brain-derived recombinant antibodies identifies multiple epitopes in the C...

ID: 1778912

Description: epitope description:GPLYQMNDALLL host organism:Homo sapiens antibody name:rAb 3B

Screening random peptide libraries with subacute sclerosing panencephalitis brain-derived recombinant antibodies identifies multiple epitopes in the C...

ID: 1778919

Description: epitope description:QDSRRSADALLRLQAMAGISEEQGSDTDTPIVYNDRN antigen name:Nucleoprotein host organism:Homo sapiens antibody name:rAb 2B4

Epitope mapping of inhibitory antibodies against platelet glycoprotein Ibalpha reveals interaction between the leucine-rich repeat N-terminal and C-te...

ID: 1778924

Description: epitope description:MCPEMSFVAVHSCAR host organism:Mus musculus antibody name:12E4

Epitope mapping of inhibitory antibodies against platelet glycoprotein Ibalpha reveals interaction between the leucine-rich repeat N-terminal and C-te...

ID: 1778927

Description: epitope description:KPGEMRGAA host organism:Mus musculus antibody name:6B4

Epitope mapping of inhibitory antibodies against platelet glycoprotein Ibalpha reveals interaction between the leucine-rich repeat N-terminal and C-te...

ID: 1778935

Description: epitope description:CNKPGERTC host organism:Mus musculus antibody name:6B4

Epitope mapping of inhibitory antibodies against platelet glycoprotein Ibalpha reveals interaction between the leucine-rich repeat N-terminal and C-te...

ID: 1778937

Description: epitope description:CADQKPGEC host organism:Mus musculus antibody name:6B4

Epitope mapping of inhibitory antibodies against platelet glycoprotein Ibalpha reveals interaction between the leucine-rich repeat N-terminal and C-te...

ID: 1778938

Description: epitope description:CYKPGEWAC host organism:Mus musculus antibody name:6B4