Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 5 of 1,510,353 results for " "

  1. Identification and characterization of peptides mimicking the epitopes of metalloprotease of Schistosoma japonicum.

    ID: 1471159

    Description: epitope description:MEASHTHARPAP host organism:Mus musculus Kunming

    Publication: 16212890;

  2. Sex-dependent neutralizing humoral response to Schistosoma mansoni 28GST antigen in infected human populations.

    ID: 1471289

    Description: epitope description:YFDGRGRAESIRMTLVAAGVDYEDERISFQDWPK antigen name:Glutathione S-transferase class-mu 28 kDa isozyme host organism:Homo sapiens

    Publication: 10823801;

  3. Mimotope of Leptospira from phage-displayed random peptide library is reactive with both monoclonal antibodies and patients' sera.

    ID: 1471316

    Description: epitope description:LTPCD antigen name:Other Leptospira interrogans protein host organism:Homo sapiens antibody name:Human sera

    Publication: 16581206;

  4. Mimotope of Leptospira from phage-displayed random peptide library is reactive with both monoclonal antibodies and patients' sera.

    ID: 1471348

    Description: epitope description:SSKSYR antigen name:Other Leptospira interrogans protein host organism:Mus musculus antibody name:mAb P1

    Publication: 16581206;

  5. Mimotope of Leptospira from phage-displayed random peptide library is reactive with both monoclonal antibodies and patients' sera.

    ID: 1471349

    Description: epitope description:KSGRC antigen name:Other Leptospira interrogans protein host organism:Mus musculus antibody name:mAb P2

    Publication: 16581206;
Displaying 5 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston