Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "

  1. Molecular fine-specificity analysis of antibody responses to human cytomegalovirus and design of novel synthetic-peptide-based serodiagnostic assays.

    ID: 1385392

    Description: epitope description:TPTPVNPSTAPAPAPTPTFACCQTPVNGNSPWAPTAPLPGDM antigen name:Other Human betaherpesvirus 5 (Human cytomegalovirus) protein host organis...

    Publication: 9854087;

  2. Molecular fine-specificity analysis of antibody responses to human cytomegalovirus and design of novel synthetic-peptide-based serodiagnostic assays.

    ID: 1385397

    Description: epitope description:FLTEEPFQRGDPFDKNYVGNSGKSRGGG antigen name:DNA polymerase processivity factor host organism:Homo sapiens

    Publication: 9854087;

  3. Molecular fine-specificity analysis of antibody responses to human cytomegalovirus and design of novel synthetic-peptide-based serodiagnostic assays.

    ID: 1385400

    Description: epitope description:GGSLSSLANAGGLHDDG antigen name:DNA polymerase processivity factor host organism:Homo sapiens

    Publication: 9854087;

  4. Antibodies against heat shock protein 60 derived from Helicobacter pylori: diagnostic implications in cardiovascular disease.

    ID: 1386143

    Description: epitope description:QVATISAN antigen name:60 kDa chaperonin host organism:Homo sapiens

    Publication: 17606364;

  5. Antibodies against heat shock protein 60 derived from Helicobacter pylori: diagnostic implications in cardiovascular disease.

    ID: 1386145

    Description: epitope description:DELDVVEGMQFDRGYLS antigen name:60 kDa chaperonin host organism:Homo sapiens

    Publication: 17606364;

  6. A novel approach for investigation of specific and cross-reactive IgE epitopes on Bet v 1 and homologous food allergens in individual patients.

    ID: 1386817

    Description: epitope description:EPDKMTT host organism:Homo sapiens antibody name:patient #1 serum IgE

    Publication: 16199263;

  7. A novel approach for investigation of specific and cross-reactive IgE epitopes on Bet v 1 and homologous food allergens in individual patients.

    ID: 1387369

    Description: epitope description:AVTFSKG host organism:Homo sapiens antibody name:patient #1 serum IgE

    Publication: 16199263;

  8. A novel approach for investigation of specific and cross-reactive IgE epitopes on Bet v 1 and homologous food allergens in individual patients.

    ID: 1387895

    Description: epitope description:IKLPALF host organism:Homo sapiens antibody name:patient #2 serum IgE

    Publication: 16199263;

  9. A novel approach for investigation of specific and cross-reactive IgE epitopes on Bet v 1 and homologous food allergens in individual patients.

    ID: 1387896

    Description: epitope description:IKLPALF host organism:Homo sapiens antibody name:patient #2 serum IgE

    Publication: 16199263;

  10. Epstein-Barr virus nuclear antigen 1 linear epitopes that are reactive with immunoglobulin A (IgA) or IgG in sera from nasopharyngeal carcinoma patien...

    ID: 1376855

    Description: epitope description:AGAGGGAGGAGAGGGAGGAG antigen name:Epstein-Barr nuclear antigen 1 host organism:Homo sapiens

    Publication: 1719023;
Displaying 10 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston