Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 100 of 1,510,353 results for " "

  1. Epitope mapping of inhibitory antibodies against platelet glycoprotein Ibalpha reveals interaction between the leucine-rich repeat N-terminal and C-te...

    ID: 1778940

    Description: epitope description:CKPVENRAC host organism:Mus musculus antibody name:6B4

    Publication: 11468163;

  2. Epitope mapping of inhibitory antibodies against platelet glycoprotein Ibalpha reveals interaction between the leucine-rich repeat N-terminal and C-te...

    ID: 1778952

    Description: epitope description:KPGEMR host organism:Mus musculus antibody name:6B4

    Publication: 11468163;

  3. Epitope mapping of inhibitory antibodies against platelet glycoprotein Ibalpha reveals interaction between the leucine-rich repeat N-terminal and C-te...

    ID: 1778959

    Description: epitope description:LPPGLHVFPLASNRS host organism:Mus musculus antibody name:6B4

    Publication: 11468163;

  4. Epitope mapping of inhibitory antibodies against platelet glycoprotein Ibalpha reveals interaction between the leucine-rich repeat N-terminal and C-te...

    ID: 1778960

    Description: epitope description:NAENVYVWKQG˙VDVKAM˙TSNVAS host organism:Mus musculus antibody name:6B4

    Publication: 11468163;

  5. Epitope mapping of inhibitory antibodies against platelet glycoprotein Ibalpha reveals interaction between the leucine-rich repeat N-terminal and C-te...

    ID: 1778961

    Description: epitope description:CNKPGERTC host organism:Mus musculus antibody name:6B4

    Publication: 11468163;

  6. Epitope mapping of inhibitory antibodies against platelet glycoprotein Ibalpha reveals interaction between the leucine-rich repeat N-terminal and C-te...

    ID: 1778976

    Description: epitope description:EGLYSPWWPRSLPVL host organism:Mus musculus antibody name:6B4

    Publication: 11468163;

  7. Epitope mapping of inhibitory antibodies against platelet glycoprotein Ibalpha reveals interaction between the leucine-rich repeat N-terminal and C-te...

    ID: 1779007

    Description: epitope description:KPGEMR host organism:Mus musculus antibody name:6B4

    Publication: 11468163;

  8. Epitope mapping of inhibitory antibodies against platelet glycoprotein Ibalpha reveals interaction between the leucine-rich repeat N-terminal and C-te...

    ID: 1779009

    Description: epitope description:KPGDPSALHVVRCWIC host organism:Mus musculus antibody name:6B4

    Publication: 11468163;

  9. Epitope mapping of inhibitory antibodies against platelet glycoprotein Ibalpha reveals interaction between the leucine-rich repeat N-terminal and C-te...

    ID: 1779015

    Description: epitope description:NAENVYVWKQG˙VDVKAM˙TSNVAS host organism:Mus musculus antibody name:6B4

    Publication: 11468163;

  10. Epitope mapping of inhibitory antibodies against platelet glycoprotein Ibalpha reveals interaction between the leucine-rich repeat N-terminal and C-te...

    ID: 1779016

    Description: epitope description:CNKPGERTC host organism:Mus musculus antibody name:6B4

    Publication: 11468163;

  11. Fine epitope mapping of monoclonal antibodies to the NH2-terminal part of von Willebrand factor (vWF) by using recombinant and synthetic peptides: int...

    ID: 1779479

    Description: epitope description:MVRHENRCVA antigen name:von Willebrand factor host organism:Mus musculus BALB/c antibody name:MoAb 32B12

    Publication: 7524613;

  12. Assay for measurement of intact B-type natriuretic peptide prohormone in blood.

    ID: 1779507

    Description: epitope description:PRSPKM antigen name:Natriuretic peptides B host organism:Mus musculus BALB/c antibody name:Hinge76

    Publication: 16574763;

  13. Evaluation of a pepscan approach to identify epitopes recognised by anti-hTSH monoclonal antibodies.

    ID: 1779509

    Description: epitope description:MMHVERKEC antigen name:Thyrotropin subunit beta host organism:Mus musculus BALB/c antibody name:mAb279

    Publication: 10078873;

  14. The sequence Glu1811-Lys1818 of human blood coagulation factor VIII comprises a binding site for activated factor IX.

    ID: 1779510

    Description: epitope description:ETKTYFWKVQ antigen name:Coagulation factor VIII host organism:Mus musculus antibody name:CLB-CAg A

    Publication: 8567641;

  15. The sequence Glu1811-Lys1818 of human blood coagulation factor VIII comprises a binding site for activated factor IX.

    ID: 1779511

    Description: epitope description:ETKTYFWKVQ antigen name:Coagulation factor VIII host organism:Mus musculus antibody name:CLB-CAg A

    Publication: 8567641;

  16. Evaluation of a pepscan approach to identify epitopes recognised by anti-hTSH monoclonal antibodies.

    ID: 1779514

    Description: epitope description:VERKECAY antigen name:Thyrotropin subunit beta host organism:Mus musculus BALB/c antibody name:mAb279

    Publication: 10078873;

  17. Evaluation of a pepscan approach to identify epitopes recognised by anti-hTSH monoclonal antibodies.

    ID: 1779515

    Description: epitope description:DVNGKLFL antigen name:Thyrotropin subunit beta host organism:Mus musculus BALB/c antibody name:mAb279

    Publication: 10078873;

  18. Evaluation of a pepscan approach to identify epitopes recognised by anti-hTSH monoclonal antibodies.

    ID: 1779519

    Description: epitope description:ECAYCLTI antigen name:Thyrotropin subunit beta host organism:Mus musculus BALB/c antibody name:mAb279

    Publication: 10078873;

  19. Identification of the polypeptide encoded by the URF-1 gene of Neurospora crassa mtDNA.

    ID: 1779579

    Description: epitope description:AETNRAPFDLAEAE antigen name:NADH-ubiquinone oxidoreductase chain 1 host organism:Oryctolagus cuniculus

    Publication: 3160590;

  20. Identification of immunodominant B- and T-cell combined epitopes in outer membrane lipoproteins LipL32 and LipL21 of Leptospira interrogans.

    ID: 1779602

    Description: epitope description:VKGSFVASVGLLFPPGIPGVSPLIHS antigen name:LipL32 host organism:Oryctolagus cuniculus

    Publication: 20237196;

  21. Identification of immunodominant B- and T-cell combined epitopes in outer membrane lipoproteins LipL32 and LipL21 of Leptospira interrogans.

    ID: 1779605

    Description: epitope description:VKTLLPYGSVINYYGYVKPG antigen name:LipL32 host organism:Oryctolagus cuniculus

    Publication: 20237196;

  22. Identification of immunodominant B- and T-cell combined epitopes in outer membrane lipoproteins LipL32 and LipL21 of Leptospira interrogans.

    ID: 1779613

    Description: epitope description:KKLLVRGLYRISFTTYK antigen name:LipL32 host organism:Homo sapiens

    Publication: 20237196;

  23. Identification of immunodominant B- and T-cell combined epitopes in outer membrane lipoproteins LipL32 and LipL21 of Leptospira interrogans.

    ID: 1779616

    Description: epitope description:DALVAKAQEVS antigen name:Outer membrane lipoprotein LipL21 host organism:Homo sapiens

    Publication: 20237196;

  24. Structure and function of the von Willebrand factor A1 domain: analysis with monoclonal antibodies reveals distinct binding sites involved in recognit...

    ID: 1779637

    Description: epitope description:IVSYLCDLAPEAPPPTLPP antigen name:von Willebrand factor host organism:Mus musculus BALB/c antibody name:6G1

    Publication: 10607699;

  25. Characterization of five Shigella flexneri variant Y-specific monoclonal antibodies using defined saccharides and glycoconjugate antigens.

    ID: 1779644

    Description: epitope description:alpha-L-Rhap-(1->3)-beta-D-GlcpNAc-(1->2)-alpha-L-Rhap-(1->2)-alpha-L-Rhap antigen name:lipopolysaccharide host organism:Rattus no...

    Publication: 2438343;

  26. Characterization of five Shigella flexneri variant Y-specific monoclonal antibodies using defined saccharides and glycoconjugate antigens.

    ID: 1779653

    Description: epitope description:alpha-L-Rhap-(1->3)-beta-D-GlcpNAc-(1->2)-alpha-L-Rhap-(1->2)-alpha-L-Rhap-(1->3)-alpha-L-Rhap-(1->3)-beta-D-GlcpNAc-(1->2)-alpha-...

    Publication: 2438343;

  27. Structure and function of the von Willebrand factor A1 domain: analysis with monoclonal antibodies reveals distinct binding sites involved in recognit...

    ID: 1779654

    Description: epitope description:RRIASQVKYAGSQVASTSE antigen name:von Willebrand factor host organism:Mus musculus BALB/c antibody name:CR3

    Publication: 10607699;

  28. Structure and function of the von Willebrand factor A1 domain: analysis with monoclonal antibodies reveals distinct binding sites involved in recognit...

    ID: 1779657

    Description: epitope description:AYIGLKDRKRPSELRRIAS antigen name:von Willebrand factor host organism:Mus musculus BALB/c antibody name:CR11, CR15

    Publication: 10607699;

  29. Characterization of five Shigella flexneri variant Y-specific monoclonal antibodies using defined saccharides and glycoconjugate antigens.

    ID: 1779664

    Description: epitope description:alpha-L-Rhap-(1->2)-L-Rhap antigen name:lipopolysaccharide host organism:Mus musculus BALB/c antibody name:MASF Y-4

    Publication: 2438343;

  30. Characterization of a cross-reactive monoclonal antibody against Norovirus genogroups I, II, III and V.

    ID: 1779665

    Description: epitope description:WIRNNF antigen name:Capsid protein VP1 host organism:Mus musculus BALB/c antibody name:N2C3

    Publication: 20417671;

  31. Characterization of a cross-reactive monoclonal antibody against Norovirus genogroups I, II, III and V.

    ID: 1779666

    Description: epitope description:WIRNNF antigen name:Capsid protein VP1 host organism:Mus musculus BALB/c antibody name:N2C3

    Publication: 20417671;

  32. Characterization of a cross-reactive monoclonal antibody against Norovirus genogroups I, II, III and V.

    ID: 1779667

    Description: epitope description:WIRNNF antigen name:Capsid protein VP1 host organism:Mus musculus BALB/c antibody name:N2C3

    Publication: 20417671;

  33. Characterization of a cross-reactive monoclonal antibody against Norovirus genogroups I, II, III and V.

    ID: 1779668

    Description: epitope description:WIRNNF antigen name:Capsid protein VP1 host organism:Mus musculus BALB/c antibody name:N2C3

    Publication: 20417671;

  34. Characterization of a cross-reactive monoclonal antibody against Norovirus genogroups I, II, III and V.

    ID: 1779670

    Description: epitope description:WIRNNF antigen name:Capsid protein VP1 host organism:Mus musculus BALB/c antibody name:N2C3

    Publication: 20417671;

  35. Structure and function of the von Willebrand factor A1 domain: analysis with monoclonal antibodies reveals distinct binding sites involved in recognit...

    ID: 1779679

    Description: epitope description:IVSYLCDLAPEAPPPTLPP antigen name:von Willebrand factor host organism:Mus musculus BALB/c antibody name:6G1

    Publication: 10607699;

  36. Characteristic features of InfA-15 monoclonal antibody recognizing H1, H3, and H5 subtypes of hemagglutinin of influenza virus A type.

    ID: 1779682

    Description: epitope description:YNAELLV antigen name:Hemagglutinin host organism:Mus musculus

    Publication: 20471600;

  37. Characteristic features of InfA-15 monoclonal antibody recognizing H1, H3, and H5 subtypes of hemagglutinin of influenza virus A type.

    ID: 1779683

    Description: epitope description:NGTYD antigen name:Hemagglutinin host organism:Mus musculus

    Publication: 20471600;

  38. Characterization of a cross-reactive monoclonal antibody against Norovirus genogroups I, II, III and V.

    ID: 1779686

    Description: epitope description:WIINNF antigen name:Capsid protein VP1 host organism:Mus musculus BALB/c antibody name:N2C3

    Publication: 20417671;

  39. Characterization of a cross-reactive monoclonal antibody against Norovirus genogroups I, II, III and V.

    ID: 1779690

    Description: epitope description:WIMSNF antigen name:Capsid protein VP1 host organism:Mus musculus BALB/c antibody name:N2C3

    Publication: 20417671;

  40. Characterization of a cross-reactive monoclonal antibody against Norovirus genogroups I, II, III and V.

    ID: 1779692

    Description: epitope description:WIRANF antigen name:Capsid protein VP1 host organism:Mus musculus BALB/c antibody name:N2C3

    Publication: 20417671;

  41. Characteristic features of InfA-15 monoclonal antibody recognizing H1, H3, and H5 subtypes of hemagglutinin of influenza virus A type.

    ID: 1779694

    Description: epitope description:GMVDGWYG antigen name:Hemagglutinin host organism:Mus musculus BALB/c antibody name:InfA-3, InfA-6, InfA-9, InfA-10, InfA-15, InfA...

    Publication: 20471600;

  42. Stable production of peptide antigens in transgenic tobacco chloroplasts by fusion to the p53 tetramerisation domain.

    ID: 1779703

    Description: epitope description:MSDGAVQPDGGQPAVRNERAT antigen name:Capsid protein VP1 host organism:Mus musculus BALB/c antibody name:3C9

    Publication: 19953346;

  43. A monoclonal antibody against a peptide sequence of fibrinogen gamma chain acts as an inhibitor of factor XIII-mediated crosslinking of human fibrin.

    ID: 1779729

    Description: epitope description:LGGAKQAGDV antigen name:Fibrinogen gamma chain host organism:Mus musculus antibody name:mAb 4A5

    Publication: 8571322;

  44. A lipopeptide based on the M2 and HA proteins of influenza A viruses induces protective antibody.

    ID: 1779731

    Description: epitope description:SLLTEVETPIRNEWG antigen name:Matrix protein 2 host organism:Mus musculus BALB/c

    Publication: 20177411;

  45. A lipopeptide based on the M2 and HA proteins of influenza A viruses induces protective antibody.

    ID: 1779736

    Description: epitope description:SLLTEVETPIRNEWG antigen name:Matrix protein 2 host organism:Mus musculus BALB/c

    Publication: 20177411;

  46. A lipopeptide based on the M2 and HA proteins of influenza A viruses induces protective antibody.

    ID: 1779742

    Description: epitope description:SLLTEVETPIRNEWG antigen name:Matrix protein 2 host organism:Mus musculus BALB/c

    Publication: 20177411;

  47. Characterization of autoantigenic epitopes on platelet glycoprotein IIb/IIIa using random peptide libraries.

    ID: 1772256

    Description: epitope description:REKAKW host organism:Homo sapiens

    Publication: 8977249;

  48. Characterization of autoantigenic epitopes on platelet glycoprotein IIb/IIIa using random peptide libraries.

    ID: 1772257

    Description: epitope description:PVVWKN host organism:Homo sapiens

    Publication: 8977249;

  49. Characterization of autoantigenic epitopes on platelet glycoprotein IIb/IIIa using random peptide libraries.

    ID: 1772258

    Description: epitope description:RELLKM host organism:Homo sapiens

    Publication: 8977249;

  50. Mapping of epitopes on the SmD molecule: the use of multiple antigen peptides to measure autoantibodies in systemic lupus erythematosus.

    ID: 1772273

    Description: epitope description:VTIELKNGTQVHGTITGVDV antigen name:Small nuclear ribonucleoprotein Sm D1 host organism:Homo sapiens

    Publication: 7507527;

  51. Mapping of epitopes on the SmD molecule: the use of multiple antigen peptides to measure autoantibodies in systemic lupus erythematosus.

    ID: 1772280

    Description: epitope description:TGVDVSMNTHLKAVKMTLKN antigen name:Small nuclear ribonucleoprotein Sm D1 host organism:Homo sapiens

    Publication: 7507527;

  52. Mapping of epitopes on the SmD molecule: the use of multiple antigen peptides to measure autoantibodies in systemic lupus erythematosus.

    ID: 1772281

    Description: epitope description:IRGNRIRYFILPDSLPLDTI antigen name:Small nuclear ribonucleoprotein Sm D1 host organism:Homo sapiens

    Publication: 7507527;

  53. Mapping of epitopes on the SmD molecule: the use of multiple antigen peptides to measure autoantibodies in systemic lupus erythematosus.

    ID: 1772284

    Description: epitope description:PLDTIRVDVEPKVKSKKREA antigen name:Small nuclear ribonucleoprotein Sm D1 host organism:Homo sapiens

    Publication: 7507527;

  54. Mapping of epitopes on the SmD molecule: the use of multiple antigen peptides to measure autoantibodies in systemic lupus erythematosus.

    ID: 1772291

    Description: epitope description:VAGRGRGRGRGRGRGRGRGRGGPRR antigen name:Small nuclear ribonucleoprotein Sm D1 host organism:Homo sapiens

    Publication: 7507527;

  55. Characterization of molecular forms of probrain natriuretic peptide in human plasma.

    ID: 1772306

    Description: epitope description:NHLQGK antigen name:Natriuretic peptides B host organism:Oryctolagus cuniculus Japanese white

    Publication: 12867297;

  56. Antibodies raised against the second extracellular loop of the human muscarinic M3 receptor mimic functional autoantibodies in Sjögren's syndrome...

    ID: 1772322

    Description: epitope description:KRTVPPGECFIQFLSEPTITFGTAI antigen name:Muscarinic acetylcholine receptor M3 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 15030576;

  57. Antibodies raised against the second extracellular loop of the human muscarinic M3 receptor mimic functional autoantibodies in Sjögren's syndrome...

    ID: 1772330

    Description: epitope description:KRTVPPGECFIQFLSEPTITFGTAI antigen name:Muscarinic acetylcholine receptor M3 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 15030576;

  58. Autoreactive antibodies are present in sheep with Johne's disease and cross-react with Mycobacterium avium subsp. paratuberculosis antigens.

    ID: 1772339

    Description: epitope description:KSLSRHDHIHHH host organism:Ovis aries

    Publication: 17544799;

  59. Conserved beta-tubulin binding domain for the microtubule-associated motors underlying sperm motility and fast axonal transport.

    ID: 1772359

    Description: epitope description:GEGMDEMEFTEAESNMNDLVSEYQQYQDATADEQGEF antigen name:Tubulin beta chain host organism:Oryctolagus cuniculus

    Publication: 1723030;

  60. Multiple deficiencies of mitochondrial DNA- and nuclear-encoded subunits of respiratory NADH dehydrogenase detected with peptide- and subunit-specific...

    ID: 1772363

    Description: epitope description:QRHLSSEPLSRKKL antigen name:NADH-ubiquinone oxidoreductase chain 4 host organism:Oryctolagus cuniculus

    Publication: 7533543;

  61. Goodpasture's epitope in development of experimental autoimmune glomerulonephritis in rats.

    ID: 1772420

    Description: epitope description:SLNPERMFRKPIPSTVKAGELEKIISRCQVCMKKRH antigen name:Collagen alpha-3(IV) chain host organism:Rattus norvegicus Wistar Kyoto

    Publication: 8821814;

  62. Goodpasture's epitope in development of experimental autoimmune glomerulonephritis in rats.

    ID: 1772422

    Description: epitope description:SLNPERMFRKPIPSTVKAGELEKIISRCQVCMKKRH antigen name:Collagen alpha-3(IV) chain host organism:Rattus norvegicus Wistar Kyoto

    Publication: 8821814;

  63. HLA class II influences the immune response and antibody diversification to Ro60/Sjögren's syndrome-A: heightened antibody responses and epitope ...

    ID: 1772461

    Description: epitope description:GMALALAVTKYKQRNGWSHKDLLRL antigen name:60 kDa SS-A/Ro ribonucleoprotein host organism:Mus musculus HLA-DQ6 Tg

    Publication: 12023392;

  64. HLA class II influences the immune response and antibody diversification to Ro60/Sjögren's syndrome-A: heightened antibody responses and epitope ...

    ID: 1772464

    Description: epitope description:ELEVIHLIEEHRLVREHLLTNHLKS antigen name:60 kDa SS-A/Ro ribonucleoprotein host organism:Mus musculus HLA-DQ6 Tg

    Publication: 12023392;

  65. HLA class II influences the immune response and antibody diversification to Ro60/Sjögren's syndrome-A: heightened antibody responses and epitope ...

    ID: 1772480

    Description: epitope description:VFTDNETFAGGVHPAIALRE antigen name:60 kDa SS-A/Ro ribonucleoprotein host organism:Mus musculus HLA-DR2 Tg

    Publication: 12023392;

  66. Receptor-associated protein and members of the low density lipoprotein receptor family share a common epitope. An extended model for the development o...

    ID: 1772509

    Description: epitope description:PVRLAEL antigen name:Alpha-2-macroglobulin receptor-associated protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 8910522;

  67. Two short autoepitopes on the nuclear dot antigen are similar to epitopes encoded by the Epstein-Barr virus.

    ID: 1772515

    Description: epitope description:PQIVPEPM antigen name:Nuclear autoantigen Sp-100 (UniProt:P23497) host organism:Oryctolagus cuniculus

    Publication: 7878031;

  68. Two short autoepitopes on the nuclear dot antigen are similar to epitopes encoded by the Epstein-Barr virus.

    ID: 1772519

    Description: epitope description:EVFISAPR antigen name:Nuclear autoantigen Sp-100 (UniProt:P23497) host organism:Homo sapiens

    Publication: 7878031;

  69. Two short autoepitopes on the nuclear dot antigen are similar to epitopes encoded by the Epstein-Barr virus.

    ID: 1772522

    Description: epitope description:PQIVPEPM antigen name:Nuclear autoantigen Sp-100 (UniProt:P23497) host organism:Homo sapiens

    Publication: 7878031;

  70. Two short autoepitopes on the nuclear dot antigen are similar to epitopes encoded by the Epstein-Barr virus.

    ID: 1772530

    Description: epitope description:PVFIPAPR antigen name:Protein BOLF1 host organism:Homo sapiens

    Publication: 7878031;

  71. Two short autoepitopes on the nuclear dot antigen are similar to epitopes encoded by the Epstein-Barr virus.

    ID: 1772561

    Description: epitope description:DIFIVSPR antigen name:Mumps rubulavirus protein host organism:Homo sapiens

    Publication: 7878031;

  72. Two short autoepitopes on the nuclear dot antigen are similar to epitopes encoded by the Epstein-Barr virus.

    ID: 1772575

    Description: epitope description:DVYIRTPR antigen name:Putative BBLF3 protein host organism:Homo sapiens

    Publication: 7878031;

  73. Two short autoepitopes on the nuclear dot antigen are similar to epitopes encoded by the Epstein-Barr virus.

    ID: 1772586

    Description: epitope description:PQVLPTPM antigen name:Epstein-Barr nuclear antigen 4 host organism:Homo sapiens

    Publication: 7878031;

  74. Multiple deficiencies of mitochondrial DNA- and nuclear-encoded subunits of respiratory NADH dehydrogenase detected with peptide- and subunit-specific...

    ID: 1772618

    Description: epitope description:QRHLSSEPLSRKKL antigen name:NADH-ubiquinone oxidoreductase chain 4 host organism:Oryctolagus cuniculus

    Publication: 7533543;

  75. Multiple deficiencies of mitochondrial DNA- and nuclear-encoded subunits of respiratory NADH dehydrogenase detected with peptide- and subunit-specific...

    ID: 1772620

    Description: epitope description:RWGNQPERLNA antigen name:NADH-ubiquinone oxidoreductase chain 4 host organism:Oryctolagus cuniculus

    Publication: 7533543;

  76. Multiple deficiencies of mitochondrial DNA- and nuclear-encoded subunits of respiratory NADH dehydrogenase detected with peptide- and subunit-specific...

    ID: 1772653

    Description: epitope description:THHINNMKPSFTRENT antigen name:NADH-ubiquinone oxidoreductase chain 4 host organism:Oryctolagus cuniculus

    Publication: 7533543;

  77. Multiple deficiencies of mitochondrial DNA- and nuclear-encoded subunits of respiratory NADH dehydrogenase detected with peptide- and subunit-specific...

    ID: 1772659

    Description: epitope description:PDIITGFSS antigen name:NADH-ubiquinone oxidoreductase chain 4 host organism:Oryctolagus cuniculus

    Publication: 7533543;

  78. Multiple deficiencies of mitochondrial DNA- and nuclear-encoded subunits of respiratory NADH dehydrogenase detected with peptide- and subunit-specific...

    ID: 1772661

    Description: epitope description:PDIITGFSS antigen name:NADH-ubiquinone oxidoreductase chain 4 host organism:Oryctolagus cuniculus

    Publication: 7533543;

  79. Structural characterization and optimization of antibody-selected phage library mimotopes of an antigen associated with autoimmune recurrent thrombosi...

    ID: 1772672

    Description: epitope description:AGPCILLARDRCPG host organism:Homo sapiens Caucasian antibody name:ACA 6501

    Publication: 9819200;

  80. Structural characterization and optimization of antibody-selected phage library mimotopes of an antigen associated with autoimmune recurrent thrombosi...

    ID: 1772673

    Description: epitope description:AGPCILLARDRCPG host organism:Homo sapiens Caucasian antibody name:ACA 6501

    Publication: 9819200;

  81. Structural characterization and optimization of antibody-selected phage library mimotopes of an antigen associated with autoimmune recurrent thrombosi...

    ID: 1772675

    Description: epitope description:AGPCLLLAPDRCPG host organism:Homo sapiens Caucasian antibody name:ACA 6501

    Publication: 9819200;

  82. Mapping of B cell epitopes on the zona pellucida 2 protein of a marsupial, the brushtail possum (Trichosurus vulpecula).

    ID: 1772688

    Description: epitope description:YRVNLKFLPNETTSN antigen name:Zona pellucida 2 protein host organism:Trichosurus vulpecula

    Publication: 15685627;

  83. Mapping of B cell epitopes on the zona pellucida 2 protein of a marsupial, the brushtail possum (Trichosurus vulpecula).

    ID: 1772719

    Description: epitope description:AAGVLHYEQENNHLY antigen name:Zona pellucida 2 protein host organism:Trichosurus vulpecula

    Publication: 15685627;

  84. Mapping of B cell epitopes on the zona pellucida 2 protein of a marsupial, the brushtail possum (Trichosurus vulpecula).

    ID: 1772723

    Description: epitope description:LHFNKRILKSKMSES antigen name:Zona pellucida 2 protein host organism:Trichosurus vulpecula

    Publication: 15685627;

  85. Mapping of B cell epitopes on the zona pellucida 2 protein of a marsupial, the brushtail possum (Trichosurus vulpecula).

    ID: 1772725

    Description: epitope description:DGFMDFEVYSHQTKP antigen name:Zona pellucida 2 protein host organism:Trichosurus vulpecula

    Publication: 15685627;

  86. Mapping of B cell epitopes on the zona pellucida 2 protein of a marsupial, the brushtail possum (Trichosurus vulpecula).

    ID: 1772726

    Description: epitope description:HQTKPALNLDTLQVR antigen name:Zona pellucida 2 protein host organism:Trichosurus vulpecula

    Publication: 15685627;

  87. Epitopes in the interacting regions of beta-dystroglycan (PPxY motif) and dystrophin (WW domain).

    ID: 1772776

    Description: epitope description:3057S, 3059Q, 3060G, 3061P, 3062W, 3064R, 3065A antigen name:Dystrophin (UniProt:P11532) host organism:Mus musculus BALB/c antibod...

    Publication: 11420143;

  88. Epitopes in the interacting regions of beta-dystroglycan (PPxY motif) and dystrophin (WW domain).

    ID: 1772778

    Description: epitope description:3057S, 3059Q, 3060G, 3061P, 3062W, 3064R, 3065A antigen name:Dystrophin (UniProt:P11532) host organism:Mus musculus BALB/c antibod...

    Publication: 11420143;

  89. Definition of a discontinuous immunodominant epitope of intestinal alkaline phosphatase, an autoantigen in acute bacterial infections.

    ID: 1772780

    Description: epitope description:PEYPDDASVNGVRKRKQNLV antigen name:Intestinal-type alkaline phosphatase host organism:Homo sapiens

    Publication: 8811051;

  90. Definition of a discontinuous immunodominant epitope of intestinal alkaline phosphatase, an autoantigen in acute bacterial infections.

    ID: 1772781

    Description: epitope description:NGVRKRKQNLVQAWQAKHQGAQY antigen name:Intestinal-type alkaline phosphatase host organism:Homo sapiens

    Publication: 8811051;

  91. Definition of a discontinuous immunodominant epitope of intestinal alkaline phosphatase, an autoantigen in acute bacterial infections.

    ID: 1772784

    Description: epitope description:MTEVALRVVSRNPRGFY antigen name:Intestinal-type alkaline phosphatase host organism:Homo sapiens

    Publication: 8811051;

  92. Definition of a discontinuous immunodominant epitope of intestinal alkaline phosphatase, an autoantigen in acute bacterial infections.

    ID: 1772786

    Description: epitope description:HSHVFSFGGYTLRGTSIFG antigen name:Intestinal-type alkaline phosphatase host organism:Homo sapiens

    Publication: 8811051;

  93. Definition of a discontinuous immunodominant epitope of intestinal alkaline phosphatase, an autoantigen in acute bacterial infections.

    ID: 1772787

    Description: epitope description:HSHVFSFGGYTLRGTSIFG antigen name:Intestinal-type alkaline phosphatase host organism:Homo sapiens

    Publication: 8811051;

  94. Definition of a discontinuous immunodominant epitope of intestinal alkaline phosphatase, an autoantigen in acute bacterial infections.

    ID: 1772790

    Description: epitope description:GLAPSKALDSKSYTSIL antigen name:Intestinal-type alkaline phosphatase host organism:Homo sapiens

    Publication: 8811051;

  95. Definition of a discontinuous immunodominant epitope of intestinal alkaline phosphatase, an autoantigen in acute bacterial infections.

    ID: 1772795

    Description: epitope description:THGGEDVAVFARGPQAHLVHGV antigen name:Intestinal-type alkaline phosphatase host organism:Homo sapiens

    Publication: 8811051;

  96. Definition of a discontinuous immunodominant epitope of intestinal alkaline phosphatase, an autoantigen in acute bacterial infections.

    ID: 1772796

    Description: epitope description:EYPDDASVNGVRK antigen name:Intestinal-type alkaline phosphatase host organism:Homo sapiens

    Publication: 8811051;

  97. Definition of a discontinuous immunodominant epitope of intestinal alkaline phosphatase, an autoantigen in acute bacterial infections.

    ID: 1772803

    Description: epitope description:WQAKHQGAQYVWN antigen name:Intestinal-type alkaline phosphatase host organism:Homo sapiens

    Publication: 8811051;

  98. Definition of a discontinuous immunodominant epitope of intestinal alkaline phosphatase, an autoantigen in acute bacterial infections.

    ID: 1772807

    Description: epitope description:VALRVVSRNPRGF antigen name:Intestinal-type alkaline phosphatase host organism:Homo sapiens

    Publication: 8811051;

  99. Definition of a discontinuous immunodominant epitope of intestinal alkaline phosphatase, an autoantigen in acute bacterial infections.

    ID: 1772808

    Description: epitope description:HSHVFSFGGYTLR antigen name:Intestinal-type alkaline phosphatase host organism:Homo sapiens

    Publication: 8811051;

  100. Definition of a discontinuous immunodominant epitope of intestinal alkaline phosphatase, an autoantigen in acute bacterial infections.

    ID: 1772812

    Description: epitope description:RGTSIFGLAPSKA antigen name:Intestinal-type alkaline phosphatase host organism:Homo sapiens

    Publication: 8811051;
Displaying 100 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston