Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Protective and nonprotective epitopes from amino termini of M proteins from Australian aboriginal isolates and reference strains of group A streptococ...

    ID: 1318287

    Description: epitope description:DNGKAIYERARERALQELGP antigen name:Other Streptococcus pyogenes protein host organism:Mus musculus B10.BR

    Publication: 11083769;

  2. Immune response to epitopes of hepatitis C virus (HCV) structural proteins in HCV-infected humans and chimpanzees.

    ID: 1318301

    Description: epitope description:CGWAGWLLSPRG antigen name:Genome polyprotein host organism:Pan troglodytes

    Publication: 8603958;

  3. Immune response to epitopes of hepatitis C virus (HCV) structural proteins in HCV-infected humans and chimpanzees.

    ID: 1318305

    Description: epitope description:RSRNLGKVIDTL antigen name:Genome polyprotein host organism:Pan troglodytes

    Publication: 8603958;

  4. Immune response to epitopes of hepatitis C virus (HCV) structural proteins in HCV-infected humans and chimpanzees.

    ID: 1318316

    Description: epitope description:LLSCLTVPASA antigen name:Genome polyprotein host organism:Pan troglodytes

    Publication: 8603958;

  5. Immune response to epitopes of hepatitis C virus (HCV) structural proteins in HCV-infected humans and chimpanzees.

    ID: 1318317

    Description: epitope description:SGLYHVTNDCPN antigen name:Genome polyprotein host organism:Pan troglodytes

    Publication: 8603958;

  6. Immune response to epitopes of hepatitis C virus (HCV) structural proteins in HCV-infected humans and chimpanzees.

    ID: 1318321

    Description: epitope description:HTPGCVPCVREG antigen name:Genome polyprotein host organism:Pan troglodytes

    Publication: 8603958;

  7. Immune response to epitopes of hepatitis C virus (HCV) structural proteins in HCV-infected humans and chimpanzees.

    ID: 1318322

    Description: epitope description:NASRCWVAVTPT antigen name:Genome polyprotein host organism:Pan troglodytes

    Publication: 8603958;

  8. Immune response to epitopes of hepatitis C virus (HCV) structural proteins in HCV-infected humans and chimpanzees.

    ID: 1318331

    Description: epitope description:SPRHHWTTQDCN antigen name:Genome polyprotein host organism:Pan troglodytes

    Publication: 8603958;

  9. Immune response to epitopes of hepatitis C virus (HCV) structural proteins in HCV-infected humans and chimpanzees.

    ID: 1318333

    Description: epitope description:CSIYPGHITGHR antigen name:Genome polyprotein host organism:Pan troglodytes

    Publication: 8603958;

  10. Immune response to epitopes of hepatitis C virus (HCV) structural proteins in HCV-infected humans and chimpanzees.

    ID: 1318336

    Description: epitope description:VAQLLRIP antigen name:Genome polyprotein host organism:Pan troglodytes

    Publication: 8603958;

  11. Immune response to epitopes of hepatitis C virus (HCV) structural proteins in HCV-infected humans and chimpanzees.

    ID: 1318343

    Description: epitope description:KVLVVLL antigen name:Genome polyprotein host organism:Pan troglodytes

    Publication: 8603958;

  12. Immune response to epitopes of hepatitis C virus (HCV) structural proteins in HCV-infected humans and chimpanzees.

    ID: 1318344

    Description: epitope description:LFAGVDA antigen name:Genome polyprotein host organism:Pan troglodytes

    Publication: 8603958;

  13. Immune response to epitopes of hepatitis C virus (HCV) structural proteins in HCV-infected humans and chimpanzees.

    ID: 1318354

    Description: epitope description:LASCRRLTDFAQ antigen name:Genome polyprotein host organism:Pan troglodytes

    Publication: 8603958;

  14. Immune response to epitopes of hepatitis C virus (HCV) structural proteins in HCV-infected humans and chimpanzees.

    ID: 1318356

    Description: epitope description:GWGPISYANGSG antigen name:Genome polyprotein host organism:Pan troglodytes

    Publication: 8603958;

  15. Interaction of immune sera with synthetic peptides corresponding to the structural protein region of hepatitis C virus.

    ID: 1316172

    Description: epitope description:WGVLAGIAYY antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 1373489;

  16. Interaction of immune sera with synthetic peptides corresponding to the structural protein region of hepatitis C virus.

    ID: 1316177

    Description: epitope description:YYSMVGNWAK antigen name:Genome polyprotein host organism:Pan troglodytes

    Publication: 1373489;

  17. Interaction of immune sera with synthetic peptides corresponding to the structural protein region of hepatitis C virus.

    ID: 1316179

    Description: epitope description:VGNWAKVLIV antigen name:Genome polyprotein host organism:Pan troglodytes

    Publication: 1373489;

  18. Interaction of immune sera with synthetic peptides corresponding to the structural protein region of hepatitis C virus.

    ID: 1316181

    Description: epitope description:AKVLIVALLF antigen name:Genome polyprotein host organism:Pan troglodytes

    Publication: 1373489;

  19. Interaction of immune sera with synthetic peptides corresponding to the structural protein region of hepatitis C virus.

    ID: 1316189

    Description: epitope description:TYTSGGAASH antigen name:Genome polyprotein host organism:Pan troglodytes

    Publication: 1373489;

  20. Interaction of immune sera with synthetic peptides corresponding to the structural protein region of hepatitis C virus.

    ID: 1316204

    Description: epitope description:NGSWHINRTA antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 1373489;

  21. Interaction of immune sera with synthetic peptides corresponding to the structural protein region of hepatitis C virus.

    ID: 1316211

    Description: epitope description:CNDSLHTGFL antigen name:Genome polyprotein host organism:Pan troglodytes

    Publication: 1373489;

  22. Interaction of immune sera with synthetic peptides corresponding to the structural protein region of hepatitis C virus.

    ID: 1316223

    Description: epitope description:PIDWFAQGWG antigen name:Genome polyprotein host organism:Pan troglodytes

    Publication: 1373489;

  23. Interaction of immune sera with synthetic peptides corresponding to the structural protein region of hepatitis C virus.

    ID: 1316230

    Description: epitope description:PDSPDQRPYC antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 1373489;

  24. Interaction of immune sera with synthetic peptides corresponding to the structural protein region of hepatitis C virus.

    ID: 1316232

    Description: epitope description:DQRPYCWHYA antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 1373489;

  25. Interaction of immune sera with synthetic peptides corresponding to the structural protein region of hepatitis C virus.

    ID: 1316234

    Description: epitope description:YCWHYAPRPG antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 1373489;

  26. Interaction of immune sera with synthetic peptides corresponding to the structural protein region of hepatitis C virus.

    ID: 1316246

    Description: epitope description:IPLVGAPLGG antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 1373489;

  27. Identification of D motif epitopes in Staphylococcus aureus fibronectin-binding protein for the production of antibody inhibitors of fibronectin bindi...

    ID: 1316250

    Description: epitope description:QGGNIVDIDFDSVP antigen name:Fibronectin-binding protein A host organism:Oryctolagus cuniculus New Zealand White antibody name:anti...

    Publication: 9009310;

  28. Modulation of proteinase-K resistant prion protein by prion peptide immunization.

    ID: 1316289

    Description: epitope description:SAMSRPMIHFGNDWEDRYYR antigen name:Major prion protein host organism:Mus musculus A/J

    Publication: 11477546;

  29. Modulation of proteinase-K resistant prion protein by prion peptide immunization.

    ID: 1316298

    Description: epitope description:ITIKQHTFTTTTKGENFTETD antigen name:Major prion protein host organism:Mus musculus A/J

    Publication: 11477546;

  30. Modulation of proteinase-K resistant prion protein by prion peptide immunization.

    ID: 1316305

    Description: epitope description:WNTGGSRYPGQGSPGGNRYP antigen name:Major prion protein host organism:Mus musculus C57BL/6

    Publication: 11477546;

  31. Identification of D motif epitopes in Staphylococcus aureus fibronectin-binding protein for the production of antibody inhibitors of fibronectin bindi...

    ID: 1316317

    Description: epitope description:EEDTEEDKPK antigen name:Fibronectin-binding protein A host organism:Oryctolagus cuniculus New Zealand White antibody name:anti-D1-...

    Publication: 9009310;

  32. Identification of D motif epitopes in Staphylococcus aureus fibronectin-binding protein for the production of antibody inhibitors of fibronectin bindi...

    ID: 1316322

    Description: epitope description:EEDKPKYEQG antigen name:Fibronectin-binding protein A host organism:Oryctolagus cuniculus New Zealand White antibody name:anti-D1-...

    Publication: 9009310;

  33. Identification of D motif epitopes in Staphylococcus aureus fibronectin-binding protein for the production of antibody inhibitors of fibronectin bindi...

    ID: 1316324

    Description: epitope description:DKPKYEQGGN antigen name:Fibronectin-binding protein A host organism:Oryctolagus cuniculus New Zealand White antibody name:anti-GST...

    Publication: 9009310;

  34. Identification of D motif epitopes in Staphylococcus aureus fibronectin-binding protein for the production of antibody inhibitors of fibronectin bindi...

    ID: 1316327

    Description: epitope description:YEQGGNIVDI antigen name:Fibronectin-binding protein A host organism:Oryctolagus cuniculus New Zealand White antibody name:anti-GST...

    Publication: 9009310;

  35. Identification of D motif epitopes in Staphylococcus aureus fibronectin-binding protein for the production of antibody inhibitors of fibronectin bindi...

    ID: 1316329

    Description: epitope description:QGGNIVDIDF antigen name:Fibronectin-binding protein A host organism:Oryctolagus cuniculus New Zealand White antibody name:anti-D1-...

    Publication: 9009310;

  36. Identification of D motif epitopes in Staphylococcus aureus fibronectin-binding protein for the production of antibody inhibitors of fibronectin bindi...

    ID: 1316339

    Description: epitope description:DSVPQIHGQN antigen name:Fibronectin-binding protein A host organism:Oryctolagus cuniculus New Zealand White antibody name:anti-GST...

    Publication: 9009310;

  37. Identification of D motif epitopes in Staphylococcus aureus fibronectin-binding protein for the production of antibody inhibitors of fibronectin bindi...

    ID: 1316341

    Description: epitope description:VPQIHGQNKG antigen name:Fibronectin-binding protein A host organism:Oryctolagus cuniculus New Zealand White antibody name:anti-GST...

    Publication: 9009310;

  38. Identification of D motif epitopes in Staphylococcus aureus fibronectin-binding protein for the production of antibody inhibitors of fibronectin bindi...

    ID: 1316351

    Description: epitope description:NQSFEEDTEK antigen name:Fibronectin-binding protein A host organism:Oryctolagus cuniculus New Zealand White antibody name:anti-GST...

    Publication: 9009310;

  39. Identification of D motif epitopes in Staphylococcus aureus fibronectin-binding protein for the production of antibody inhibitors of fibronectin bindi...

    ID: 1316352

    Description: epitope description:NQSFEEDTEK antigen name:Fibronectin-binding protein A host organism:Oryctolagus cuniculus New Zealand White antibody name:anti-D1-...

    Publication: 9009310;

  40. Identification of D motif epitopes in Staphylococcus aureus fibronectin-binding protein for the production of antibody inhibitors of fibronectin bindi...

    ID: 1316364

    Description: epitope description:IIEEDTNKDK antigen name:Fibronectin-binding protein A host organism:Oryctolagus cuniculus New Zealand White antibody name:anti-D1-...

    Publication: 9009310;

  41. Identification of D motif epitopes in Staphylococcus aureus fibronectin-binding protein for the production of antibody inhibitors of fibronectin bindi...

    ID: 1316370

    Description: epitope description:NKDKPSYQFG antigen name:Fibronectin-binding protein A host organism:Oryctolagus cuniculus New Zealand White antibody name:anti-D1-...

    Publication: 9009310;

  42. Identification of D motif epitopes in Staphylococcus aureus fibronectin-binding protein for the production of antibody inhibitors of fibronectin bindi...

    ID: 1316373

    Description: epitope description:PSYQFGGHNS antigen name:Fibronectin-binding protein A host organism:Oryctolagus cuniculus New Zealand White antibody name:anti-GST...

    Publication: 9009310;

  43. Identification of D motif epitopes in Staphylococcus aureus fibronectin-binding protein for the production of antibody inhibitors of fibronectin bindi...

    ID: 1316374

    Description: epitope description:PSYQFGGHNS antigen name:Fibronectin-binding protein A host organism:Oryctolagus cuniculus New Zealand White antibody name:anti-D1-...

    Publication: 9009310;

  44. Interaction of immune sera with synthetic peptides corresponding to the structural protein region of hepatitis C virus.

    ID: 1316393

    Description: epitope description:GSGPDQRPYC antigen name:Genome polyprotein host organism:Pan troglodytes

    Publication: 1373489;

  45. Epitope mapping by negative selection of randomized antigen libraries displayed on filamentous phage.

    ID: 1316520

    Description: epitope description:RAWAYM host organism:Mus musculus BALB/c antibody name:MA-3G10

    Publication: 9223635;

  46. Synthetic peptide vaccines yield monoclonal antibodies to cellular and pathological prion proteins of ruminants.

    ID: 1316527

    Description: epitope description:MVKSHIGSWILVLFVA antigen name:Major prion protein host organism:Mus musculus

    Publication: 9568991;

  47. Antigenic features of prion proteins of sheep and of other mammalian species.

    ID: 1316535

    Description: epitope description:GGGGWGQGGSHSQWNK antigen name:Major prion protein host organism:Oryctolagus cuniculus Chinchilla antibody name:Ra anti 89-104

    Publication: 9328590;

  48. Synthetic peptide vaccines yield monoclonal antibodies to cellular and pathological prion proteins of ruminants.

    ID: 1316559

    Description: epitope description:SHSQWNKPSKPKTNMK antigen name:Major prion protein host organism:Mus musculus

    Publication: 9568991;

  49. Synthetic peptide vaccines yield monoclonal antibodies to cellular and pathological prion proteins of ruminants.

    ID: 1316565

    Description: epitope description:GNDYEDRYYRENMYRYPNQV antigen name:Major prion protein host organism:Mus musculus

    Publication: 9568991;

  50. Identification and characterization of the neutralization epitope(s) of the hepatitis E virus.

    ID: 1316571

    Description: epitope description:SELVIPSERLHYRNQGWRSVETSGVAEEEA antigen name:Capsid protein host organism:Mus musculus

    Publication: 11601892;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston