Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 100 of 1,510,353 results for " "

  1. Definition of a discontinuous immunodominant epitope of intestinal alkaline phosphatase, an autoantigen in acute bacterial infections.

    ID: 1772816

    Description: epitope description:ALDSKSYTSILYG antigen name:Intestinal-type alkaline phosphatase host organism:Homo sapiens

    Publication: 8811051;

  2. Definition of a discontinuous immunodominant epitope of intestinal alkaline phosphatase, an autoantigen in acute bacterial infections.

    ID: 1772822

    Description: epitope description:GGEDVAVFARGPQ antigen name:Intestinal-type alkaline phosphatase host organism:Homo sapiens

    Publication: 8811051;

  3. Crystal structure of the von Willebrand factor A1 domain in complex with the function blocking NMC-4 Fab.

    ID: 1772912

    Description: epitope description:P1390, Q1391, R1392, S1394, R1395, N1396, F1397, V1398, R1399, N1421, K1423, Q1424, L1427 antigen name:von Willebrand factor host ...

    Publication: 9501911;

  4. CD20 mimicry by a mAb rituximab-specific linear peptide: a potential tool for active immunotherapy of autoimmune diseases.

    ID: 1772929

    Description: epitope description:ITPWPHWLERSS host organism:Mus musculus antibody name:Rituximab

    Publication: 16127008;

  5. CD20 mimicry by a mAb rituximab-specific linear peptide: a potential tool for active immunotherapy of autoimmune diseases.

    ID: 1772936

    Description: epitope description:YNCEPANPSEKNSPSTQYCY antigen name:B-lymphocyte antigen CD20 host organism:Mus musculus BALB/c

    Publication: 16127008;

  6. Domain specific monoclonal anti-factor VIII antibodies generated by inclusion body-renatured factor VIII peptides.

    ID: 1772939

    Description: epitope description:YDEDENQSPRSFQKKTRHYFIAAV antigen name:Coagulation factor VIII host organism:Mus musculus BALB/c antibody name:D2

    Publication: 11297757;

  7. Vaccination against weight gain.

    ID: 1772941

    Description: epitope description:GSSFLSPEHQ + MCM(S3) antigen name:Appetite-regulating hormone host organism:Rattus norvegicus Wistar

    Publication: 16891413;

  8. Vaccination against weight gain.

    ID: 1772942

    Description: epitope description:GSSFLSPEHQ + MCM(S3) antigen name:Appetite-regulating hormone host organism:Rattus norvegicus Wistar

    Publication: 16891413;

  9. Vaccination against weight gain.

    ID: 1772943

    Description: epitope description:GSSFLSPEHQ + MCM(S3) antigen name:Appetite-regulating hormone host organism:Rattus norvegicus Wistar

    Publication: 16891413;

  10. Vaccination against weight gain.

    ID: 1772945

    Description: epitope description:QQRKESKKPPAKLQPR antigen name:Appetite-regulating hormone host organism:Rattus norvegicus Wistar

    Publication: 16891413;

  11. Vaccination against weight gain.

    ID: 1772948

    Description: epitope description:GSSFLSPEHQKAQQRKESKKPPAKLQPR + MCM(S3) antigen name:Appetite-regulating hormone host organism:Rattus norvegicus Wistar

    Publication: 16891413;

  12. A common epitope on human tumor necrosis factor alpha and the autoantigen 'S-antigen/arrestin' induces TNF-alpha production.

    ID: 1772973

    Description: epitope description:EPVDGVVLVDPE antigen name:S-arrestin host organism:Mus musculus BALB/c antibody name:S6H8, S2D2

    Publication: 1373060;

  13. A common epitope on human tumor necrosis factor alpha and the autoantigen 'S-antigen/arrestin' induces TNF-alpha production.

    ID: 1772975

    Description: epitope description:NGVELRD antigen name:Tumor necrosis factor host organism:Mus musculus BALB/c antibody name:S6H8, S2D2

    Publication: 1373060;

  14. Identification of the binding site for an alloantibody to von Willebrand factor which inhibits binding to glycoprotein Ib within the amino-terminal re...

    ID: 1772989

    Description: epitope description:HCQICHCDVVNLTCE antigen name:von Willebrand factor host organism:Homo sapiens

    Publication: 10365755;

  15. Identification of the binding site for an alloantibody to von Willebrand factor which inhibits binding to glycoprotein Ib within the amino-terminal re...

    ID: 1772990

    Description: epitope description:HCQICHCDVVNLTCE antigen name:von Willebrand factor host organism:Homo sapiens

    Publication: 10365755;

  16. Identification of the binding site for an alloantibody to von Willebrand factor which inhibits binding to glycoprotein Ib within the amino-terminal re...

    ID: 1772992

    Description: epitope description:VTLNPSDPEHCQICH antigen name:von Willebrand factor host organism:Homo sapiens

    Publication: 10365755;

  17. Identification of the binding site for an alloantibody to von Willebrand factor which inhibits binding to glycoprotein Ib within the amino-terminal re...

    ID: 1772995

    Description: epitope description:QEPGGLVVPPTDAPV antigen name:von Willebrand factor host organism:Homo sapiens

    Publication: 10365755;

  18. Characterisation of epitopes of pan-IgG/anti-G3m(u) and anti-Fc monoclonal antibodies.

    ID: 1772996

    Description: epitope description:KPREE antigen name:Immunoglobulin host organism:Mus musculus antibody name:G7C, JD312

    Publication: 12853166;

  19. Identification of a thrombin-interactive site within the FVIII A2 domain that is responsible for the cleavage at Arg372.

    ID: 1773004

    Description: epitope description:RPLYSRRLPKGVKHLKDFPILPGEIF antigen name:Coagulation factor VIII host organism:Mus musculus antibody name:mAb413

    Publication: 18081893;

  20. Molecular mimicry in the pathogenesis of spondyloarthropathies. A critical appraisal of cross-reactivity between microbial antigens and HLA-B27.

    ID: 1773008

    Description: epitope description:AIGDRSKTDRENSVSIG antigen name:Other Yersinia enterocolitica protein host organism:Homo sapiens

    Publication: 1555037;

  21. Molecular mimicry in the pathogenesis of spondyloarthropathies. A critical appraisal of cross-reactivity between microbial antigens and HLA-B27.

    ID: 1773011

    Description: epitope description:AIGDRSKTDRENSVSIG antigen name:Other Yersinia enterocolitica protein host organism:Homo sapiens

    Publication: 1555037;

  22. Characterization of huntingtin pathologic fragments in human Huntington disease, transgenic mice, and cell models.

    ID: 1773023

    Description: epitope description:MATLEKLMKAFESLKSF antigen name:Huntingtin host organism:Oryctolagus cuniculus antibody name:htt1-17

    Publication: 17413322;

  23. Molecular mapping of the Goodpasture's epitope for glomerulonephritis.

    ID: 1773029

    Description: epitope description:SQTTANPSCPEGT antigen name:Protein LOC100911572 host organism:Rattus norvegicus

    Publication: 16555617;

  24. Nonobese diabetic mice display elevated levels of class II-associated invariant chain peptide associated with I-Ag7 on the cell surface.

    ID: 1773031

    Description: epitope description:RMATPLLMRPMSM antigen name:H-2 class II histocompatibility antigen gamma chain host organism:Oryctolagus cuniculus

    Publication: 11254705;

  25. Nonobese diabetic mice display elevated levels of class II-associated invariant chain peptide associated with I-Ag7 on the cell surface.

    ID: 1773035

    Description: epitope description:RMATPLLMRPMSM antigen name:H-2 class II histocompatibility antigen gamma chain host organism:Oryctolagus cuniculus

    Publication: 11254705;

  26. Complementary peptides against the major epitope in the NC16A domain of BP180 show no specificity as vaccines to bullous pemphigoid.

    ID: 1773121

    Description: epitope description:SSYDGIPLSYLSYL host organism:Homo sapiens

    Publication: 10527376;

  27. Complementary peptides against the major epitope in the NC16A domain of BP180 show no specificity as vaccines to bullous pemphigoid.

    ID: 1773134

    Description: epitope description:PAYQGIPVAHISYF host organism:Oryctolagus cuniculus New Zealand White

    Publication: 10527376;

  28. Complementary peptides against the major epitope in the NC16A domain of BP180 show no specificity as vaccines to bullous pemphigoid.

    ID: 1773135

    Description: epitope description:RSILPYGDSMDRIE antigen name:Collagen alpha-1(XVII) chain host organism:Homo sapiens

    Publication: 10527376;

  29. Antineutrophil cytoplasmic antibodies to proteinase 3 in Wegener's granulomatosis: epitope analysis using synthetic peptides.

    ID: 1775633

    Description: epitope description:CFGDSGGPLICDGII antigen name:Myeloblastin host organism:Homo sapiens

    Publication: 11135067;

  30. Antineutrophil cytoplasmic antibodies to proteinase 3 in Wegener's granulomatosis: epitope analysis using synthetic peptides.

    ID: 1775639

    Description: epitope description:CDGIIQGIDSFVIWG antigen name:Myeloblastin host organism:Homo sapiens

    Publication: 11135067;

  31. Antineutrophil cytoplasmic antibodies to proteinase 3 in Wegener's granulomatosis: epitope analysis using synthetic peptides.

    ID: 1775642

    Description: epitope description:QGIDSFVIWGCATRL antigen name:Myeloblastin host organism:Homo sapiens

    Publication: 11135067;

  32. Antineutrophil cytoplasmic antibodies to proteinase 3 in Wegener's granulomatosis: epitope analysis using synthetic peptides.

    ID: 1775649

    Description: epitope description:CATRLFPDFFTRVAL antigen name:Myeloblastin host organism:Oryctolagus cuniculus

    Publication: 11135067;

  33. Antineutrophil cytoplasmic antibodies to proteinase 3 in Wegener's granulomatosis: epitope analysis using synthetic peptides.

    ID: 1775650

    Description: epitope description:CATRLFPDFFTRVAL antigen name:Myeloblastin host organism:Homo sapiens

    Publication: 11135067;

  34. Antineutrophil cytoplasmic antibodies to proteinase 3 in Wegener's granulomatosis: epitope analysis using synthetic peptides.

    ID: 1775655

    Description: epitope description:FTRVALYVDWIRSTL antigen name:Myeloblastin host organism:Oryctolagus cuniculus

    Publication: 11135067;

  35. Antineutrophil cytoplasmic antibodies to proteinase 3 in Wegener's granulomatosis: epitope analysis using synthetic peptides.

    ID: 1775658

    Description: epitope description:ALYVDWIRSTLRRVEA antigen name:Myeloblastin host organism:Oryctolagus cuniculus

    Publication: 11135067;

  36. Antineutrophil cytoplasmic antibodies to proteinase 3 in Wegener's granulomatosis: epitope analysis using synthetic peptides.

    ID: 1775659

    Description: epitope description:ALYVDWIRSTLRRVEA antigen name:Myeloblastin host organism:Homo sapiens

    Publication: 11135067;

  37. Antineutrophil cytoplasmic antibodies to proteinase 3 in Wegener's granulomatosis: epitope analysis using synthetic peptides.

    ID: 1775662

    Description: epitope description:WIRSTLRRVEAKGRP antigen name:Myeloblastin host organism:Homo sapiens

    Publication: 11135067;

  38. Screening and identification of B cell epitopes of structural proteins of foot-and-mouth disease virus serotype Asia1.

    ID: 1775667

    Description: epitope description:TTQDRRKQEIIAPEKQTL antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 19699594;

  39. Screening and identification of B cell epitopes of structural proteins of foot-and-mouth disease virus serotype Asia1.

    ID: 1775668

    Description: epitope description:TRNGHTTSTTQ antigen name:Polyprotein host organism:Oryctolagus cuniculus

    Publication: 19699594;

  40. Screening and identification of B cell epitopes of structural proteins of foot-and-mouth disease virus serotype Asia1.

    ID: 1775669

    Description: epitope description:EDAVSGPNTSG antigen name:Polyprotein host organism:Oryctolagus cuniculus

    Publication: 19699594;

  41. Screening and identification of B cell epitopes of structural proteins of foot-and-mouth disease virus serotype Asia1.

    ID: 1775671

    Description: epitope description:GELPSKE antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 19699594;

  42. Screening and identification of B cell epitopes of structural proteins of foot-and-mouth disease virus serotype Asia1.

    ID: 1775672

    Description: epitope description:YGKVSNPPRTSFPG antigen name:Polyprotein host organism:Oryctolagus cuniculus

    Publication: 19699594;

  43. Epitope specificity of neutralizing antibodies against IFN-beta.

    ID: 1775674

    Description: epitope description:MSYNLLGFLQRS antigen name:Interferon beta host organism:Homo sapiens

    Publication: 15153311;

  44. Screening and identification of B cell epitopes of structural proteins of foot-and-mouth disease virus serotype Asia1.

    ID: 1775680

    Description: epitope description:YQNSMDTQLGDN antigen name:Polyprotein host organism:Oryctolagus cuniculus

    Publication: 19699594;

  45. Epitope specificity of neutralizing antibodies against IFN-beta.

    ID: 1775684

    Description: epitope description:RSSNFQCQKLLW antigen name:Interferon beta host organism:Homo sapiens

    Publication: 15153311;

  46. Epitope specificity of neutralizing antibodies against IFN-beta.

    ID: 1775686

    Description: epitope description:LWQLNGRLEYCL antigen name:Interferon beta host organism:Homo sapiens

    Publication: 15153311;

  47. Epitope specificity of neutralizing antibodies against IFN-beta.

    ID: 1775690

    Description: epitope description:PEEIKQLQQFQK antigen name:Interferon beta host organism:Homo sapiens

    Publication: 15153311;

  48. Epitope specificity of neutralizing antibodies against IFN-beta.

    ID: 1775691

    Description: epitope description:QLQQFQKEDAAL antigen name:Interferon beta host organism:Homo sapiens

    Publication: 15153311;

  49. Epitope specificity of neutralizing antibodies against IFN-beta.

    ID: 1775698

    Description: epitope description:ETIVENLLANVY antigen name:Interferon beta host organism:Homo sapiens

    Publication: 15153311;

  50. Epitope specificity of neutralizing antibodies against IFN-beta.

    ID: 1775699

    Description: epitope description:NLLANVYHQINH antigen name:Interferon beta host organism:Homo sapiens

    Publication: 15153311;

  51. Identification of their epitope reveals the structural basis for the mechanism of action of the immunosuppressive antibodies basiliximab and daclizuma...

    ID: 1775731

    Description: epitope description:ERIYHFV antigen name:Interleukin-2 receptor subunit alpha host organism:Mus musculus BALB/c antibody name:basiliximab

    Publication: 17440057;

  52. Hypersensitivity reactions to penicillins: studies in a group of patients with negative benzylpenicillin G skin test.

    ID: 1775754

    Description: epitope description:benzylpenicillin host organism:Homo sapiens

    Publication: 19646073;

  53. Hypersensitivity reactions to penicillins: studies in a group of patients with negative benzylpenicillin G skin test.

    ID: 1775949

    Description: epitope description:phenoxymethylpenicillin host organism:Homo sapiens

    Publication: 19646073;

  54. Hypersensitivity reactions to penicillins: studies in a group of patients with negative benzylpenicillin G skin test.

    ID: 1775954

    Description: epitope description:ampicillin host organism:Homo sapiens

    Publication: 19646073;

  55. Recombinant human antibodies against aldehyde-modified apolipoprotein B-100 peptide sequences inhibit atherosclerosis.

    ID: 1775957

    Description: epitope description:IEIGLEGKGFEPTLEALFGK antigen name:Apolipoprotein B-100 host organism:Homo sapiens antibody name:IEI-A8, IEI-G8, IEI-E3, IEI-D8

    Publication: 15451805;

  56. Recombinant human antibodies against aldehyde-modified apolipoprotein B-100 peptide sequences inhibit atherosclerosis.

    ID: 1775960

    Description: epitope description:KTTKQSFDLSVKAQYKKNKH antigen name:Apolipoprotein B-100 host organism:Homo sapiens antibody name:KTT-D6, KTT-D8

    Publication: 15451805;

  57. T cell peptide of a self-protein elicits autoantibody to the protein antigen. Implications for specificity and pathogenetic role of antibody in autoim...

    ID: 1775961

    Description: epitope description:FQIHGPR antigen name:Zona pellucida sperm-binding protein 3 host organism:Mus musculus (C57BL/6 X A/J)

    Publication: 7693818;

  58. Detection of various forms of brain myelin basic protein in vertebrates by electroimmunoblotting.

    ID: 1775962

    Description: epitope description:ASDYKS antigen name:Myelin basic protein (UniProt:P02686) host organism:Mus musculus SJL X BALB/c

    Publication: 6083464;

  59. T cell peptide of a self-protein elicits autoantibody to the protein antigen. Implications for specificity and pathogenetic role of antibody in autoim...

    ID: 1775963

    Description: epitope description:NSSSSQFQIH antigen name:Zona pellucida sperm-binding protein 3 host organism:Mus musculus (C57BL/6 X A/J)

    Publication: 7693818;

  60. Detection of various forms of brain myelin basic protein in vertebrates by electroimmunoblotting.

    ID: 1775970

    Description: epitope description:ASDYKS antigen name:Myelin basic protein (UniProt:P02686) host organism:Mus musculus SJL X BALB/c

    Publication: 6083464;

  61. Epitope mapping of anti-troponin I monoclonal antibodies.

    ID: 1775994

    Description: epitope description:YRAYATEP antigen name:Troponin I, cardiac muscle host organism:Mus musculus BALB/c antibody name:10B11

    Publication: 9762417;

  62. Epitope mapping of anti-troponin I monoclonal antibodies.

    ID: 1776008

    Description: epitope description:YRAYA antigen name:Troponin I, cardiac muscle host organism:Mus musculus BALB/c antibody name:10B11

    Publication: 9762417;

  63. Epitope mapping of anti-troponin I monoclonal antibodies.

    ID: 1776011

    Description: epitope description:RVDKVDE antigen name:Troponin I, cardiac muscle host organism:Mus musculus BALB/c antibody name:10B11

    Publication: 9762417;

  64. Epitope mapping of anti-troponin I monoclonal antibodies.

    ID: 1776013

    Description: epitope description:LRAHLKQ antigen name:Troponin I, cardiac muscle host organism:Mus musculus BALB/c antibody name:10B11

    Publication: 9762417;

  65. Design of antibody-reactive peptides from discontinuous parts of scorpion toxins.

    ID: 1776030

    Description: epitope description:YYQWAPYGYFRNAYNE host organism:Oryctolagus cuniculus New Zealand White

    Publication: 19962461;

  66. Design of antibody-reactive peptides from discontinuous parts of scorpion toxins.

    ID: 1776036

    Description: epitope description:RNAYNEIKLKESY host organism:Oryctolagus cuniculus New Zealand White

    Publication: 19962461;

  67. Design of antibody-reactive peptides from discontinuous parts of scorpion toxins.

    ID: 1776037

    Description: epitope description:IKLKESNEYRNAY host organism:Oryctolagus cuniculus New Zealand White

    Publication: 19962461;

  68. Design of antibody-reactive peptides from discontinuous parts of scorpion toxins.

    ID: 1776041

    Description: epitope description:PYGQWAGRNAYNETKLK host organism:Oryctolagus cuniculus New Zealand White

    Publication: 19962461;

  69. Design of antibody-reactive peptides from discontinuous parts of scorpion toxins.

    ID: 1776042

    Description: epitope description:QWAPYGGRNAYNETKLK host organism:Oryctolagus cuniculus New Zealand White

    Publication: 19962461;

  70. Design of antibody-reactive peptides from discontinuous parts of scorpion toxins.

    ID: 1776045

    Description: epitope description:YYYNETKLKESYKVKD host organism:Oryctolagus cuniculus New Zealand White

    Publication: 19962461;

  71. Design of antibody-reactive peptides from discontinuous parts of scorpion toxins.

    ID: 1776047

    Description: epitope description:DDVTYFRTKGPGRCH host organism:Oryctolagus cuniculus New Zealand White

    Publication: 19962461;

  72. Renal autoimmune epitope of group A streptococci specified by M protein tetrapeptide Ile-Arg-Leu-Arg.

    ID: 1776102

    Description: epitope description:NGDGNPREVIEDLAANNPAIQNIRLR + CYSTL(R26) antigen name:UniProt:A2RGM0 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2454473;

  73. Correlation of peptide specificity and IgG subclass with pathogenic and nonpathogenic autoantibodies in pemphigus vulgaris: a model for autoimmunity.

    ID: 1776106

    Description: epitope description:SQEPAGTPMFLLSRNTGEVRTLTNSLDREQ antigen name:Desmoglein-3 host organism:Homo sapiens

    Publication: 7761479;

  74. Renal autoimmune epitope of group A streptococci specified by M protein tetrapeptide Ile-Arg-Leu-Arg.

    ID: 1776122

    Description: epitope description:AIQNIRLRHENKDL + CYSTL(L14) antigen name:UniProt:A2RGM0 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2454473;

  75. Renal autoimmune epitope of group A streptococci specified by M protein tetrapeptide Ile-Arg-Leu-Arg.

    ID: 1776123

    Description: epitope description:IRLRHENKDLKARL + CYSTL(L14) antigen name:UniProt:A2RGM0 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2454473;

  76. Renal autoimmune epitope of group A streptococci specified by M protein tetrapeptide Ile-Arg-Leu-Arg.

    ID: 1776125

    Description: epitope description:NGDGNPREVIEDLAANNPAIRLR + CYSTL(R23) host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2454473;

  77. Does cross-reactivity between mycobacterium avium paratuberculosis and human intestinal antigens characterize Crohn's disease?

    ID: 1776135

    Description: epitope description:TCRRMLAFLKDKENR antigen name:Other Mycobacterium avium protein host organism:Homo sapiens

    Publication: 16831593;

  78. Does cross-reactivity between mycobacterium avium paratuberculosis and human intestinal antigens characterize Crohn's disease?

    ID: 1776140

    Description: epitope description:TCRRMLAFLKDKENR antigen name:Other Mycobacterium avium protein host organism:Homo sapiens

    Publication: 16831593;

  79. Very low-dose tolerance with nucleosomal peptides controls lupus and induces potent regulatory T cell subsets.

    ID: 1776142

    Description: epitope description:TYTEHAKRKTVTAMDVVYALKRQG antigen name:Histone H4 host organism:Mus musculus SNF1

    Publication: 15749855;

  80. A functional motif QLYxxYP is essential for osteopontin induced T lymphocyte activation and migration.

    ID: 1776266

    Description: epitope description:VPTQLYNLYPPL host organism:Mus musculus antibody name:F8E11

    Publication: 19285028;

  81. A functional motif QLYxxYP is essential for osteopontin induced T lymphocyte activation and migration.

    ID: 1776274

    Description: epitope description:TVKQLYTLYPAA host organism:Mus musculus antibody name:F8E11

    Publication: 19285028;

  82. Immunodominant epitopes of alpha3(IV)NC1 induce autoimmune glomerulonephritis in rats.

    ID: 1776279

    Description: epitope description:TDIPPCPHGWISLWKGFSFIMFTSAGSEGTGQALASP antigen name:Collagen alpha-3(IV) chain host organism:Rattus norvegicus Wistar Kyoto

    Publication: 14633133;

  83. Characterization of epitopes shared by alpha-melanocyte-stimulating hormone (alpha-MSH) and the 150-kD neurofilament protein (NF150): relationship to ...

    ID: 1776284

    Description: epitope description:SYSMEHFRWG antigen name:Pro-opiomelanocortin host organism:Oryctolagus cuniculus antibody name:31H2T

    Publication: 2432275;

  84. Does cross-reactivity between mycobacterium avium paratuberculosis and human intestinal antigens characterize Crohn's disease?

    ID: 1776505

    Description: epitope description:TCRRMLAFLKDKENR antigen name:Other Mycobacterium avium protein host organism:Homo sapiens

    Publication: 16831593;

  85. Does cross-reactivity between mycobacterium avium paratuberculosis and human intestinal antigens characterize Crohn's disease?

    ID: 1776506

    Description: epitope description:TCRRMLAFLKDKENR antigen name:Other Mycobacterium avium protein host organism:Homo sapiens

    Publication: 16831593;

  86. Does cross-reactivity between mycobacterium avium paratuberculosis and human intestinal antigens characterize Crohn's disease?

    ID: 1776595

    Description: epitope description:AGDLSKVDAKQPGDY antigen name:AhpC host organism:Homo sapiens

    Publication: 16831593;

  87. Does cross-reactivity between mycobacterium avium paratuberculosis and human intestinal antigens characterize Crohn's disease?

    ID: 1776596

    Description: epitope description:AGDLSKVDAKQPGDY antigen name:AhpC host organism:Homo sapiens

    Publication: 16831593;

  88. Does cross-reactivity between mycobacterium avium paratuberculosis and human intestinal antigens characterize Crohn's disease?

    ID: 1776598

    Description: epitope description:NEHPVFAYLKDKLP antigen name:Glutathione peroxidase 2 host organism:Homo sapiens

    Publication: 16831593;

  89. Does cross-reactivity between mycobacterium avium paratuberculosis and human intestinal antigens characterize Crohn's disease?

    ID: 1776646

    Description: epitope description:CQALVRMLAKKPGWK antigen name:Cytoskeleton-associated protein 5 host organism:Homo sapiens

    Publication: 16831593;

  90. Does cross-reactivity between mycobacterium avium paratuberculosis and human intestinal antigens characterize Crohn's disease?

    ID: 1776658

    Description: epitope description:DFTYDQVAFNGLPQF antigen name:Sucrase-isomaltase, intestinal host organism:Homo sapiens

    Publication: 16831593;

  91. Does cross-reactivity between mycobacterium avium paratuberculosis and human intestinal antigens characterize Crohn's disease?

    ID: 1776659

    Description: epitope description:DFTYDQVAFNGLPQF antigen name:Sucrase-isomaltase, intestinal host organism:Homo sapiens

    Publication: 16831593;

  92. Does cross-reactivity between mycobacterium avium paratuberculosis and human intestinal antigens characterize Crohn's disease?

    ID: 1776696

    Description: epitope description:LAKLAGGVAVICAGA host organism:Homo sapiens

    Publication: 16831593;

  93. Does cross-reactivity between mycobacterium avium paratuberculosis and human intestinal antigens characterize Crohn's disease?

    ID: 1776704

    Description: epitope description:QLELTEGMRFDKGYI antigen name:60 kDa chaperonin 2 host organism:Homo sapiens

    Publication: 16831593;

  94. Characterization of murine T cell responses to peptides of the variable region of self T cell receptor beta-chains.

    ID: 1776794

    Description: epitope description:GGIITQTPKFLIGQEGQKLT antigen name:T-cell receptor host organism:Mus musculus BALB/c

    Publication: 8409384;

  95. A population of autoantibodies against a centromere-associated protein A major epitope motif cross-reacts with related cryptic epitopes on other nucle...

    ID: 1776803

    Description: epitope description:MGPKRRQLTF antigen name:Major centromere autoantigen B host organism:Homo sapiens

    Publication: 11862315;

  96. A population of autoantibodies against a centromere-associated protein A major epitope motif cross-reacts with related cryptic epitopes on other nucle...

    ID: 1776805

    Description: epitope description:AKEEPKRRSA antigen name:Non-histone chromosomal protein HMG-14 host organism:Homo sapiens

    Publication: 11862315;

  97. A population of autoantibodies against a centromere-associated protein A major epitope motif cross-reacts with related cryptic epitopes on other nucle...

    ID: 1776818

    Description: epitope description:ISDGPSKVTL antigen name:Coilin host organism:Homo sapiens

    Publication: 11862315;

  98. A population of autoantibodies against a centromere-associated protein A major epitope motif cross-reacts with related cryptic epitopes on other nucle...

    ID: 1776822

    Description: epitope description:CTFVPRRKAG antigen name:Myeloblastin host organism:Homo sapiens

    Publication: 11862315;

  99. A population of autoantibodies against a centromere-associated protein A major epitope motif cross-reacts with related cryptic epitopes on other nucle...

    ID: 1776825

    Description: epitope description:FNTGPLSVLT antigen name:Small nuclear ribonucleoprotein Sm D2 host organism:Homo sapiens

    Publication: 11862315;

  100. A population of autoantibodies against a centromere-associated protein A major epitope motif cross-reacts with related cryptic epitopes on other nucle...

    ID: 1776826

    Description: epitope description:GPSRR antigen name:Histone H3-like centromeric protein A host organism:Homo sapiens

    Publication: 11862315;
Displaying 100 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston