A population of autoantibodies against a centromere-associated protein A major epitope motif cross-reacts with related cryptic epitopes on other nucle...

ID: 1776830

Description: epitope description:GSGGSGPQRRGGDNH antigen name:Epstein-Barr nuclear antigen 1 host organism:Homo sapiens

A population of autoantibodies against a centromere-associated protein A major epitope motif cross-reacts with related cryptic epitopes on other nucle...

ID: 1776857

Description: epitope description:GGSGPQRRGG antigen name:Epstein-Barr nuclear antigen 1 host organism:Homo sapiens

Mutational analysis of thrombopoietin for identification of receptor and neutralizing antibody sites.

ID: 1776860

Description: epitope description:K73, D83, N146, L150, Q153, H154, R157, K159, R161 antigen name:Thrombopoietin host organism:Mus musculus BALB/c antibody name:mAb...

A population of autoantibodies against a centromere-associated protein A major epitope motif cross-reacts with related cryptic epitopes on other nucle...

ID: 1776861

Description: epitope description:GGSGPQRRGG antigen name:Epstein-Barr nuclear antigen 1 host organism:Homo sapiens

A population of autoantibodies against a centromere-associated protein A major epitope motif cross-reacts with related cryptic epitopes on other nucle...

ID: 1776863

Description: epitope description:MGPRRRSRKP antigen name:Histone H3-like centromeric protein A host organism:Homo sapiens

A population of autoantibodies against a centromere-associated protein A major epitope motif cross-reacts with related cryptic epitopes on other nucle...

ID: 1776865

Description: epitope description:KPEAPRRRSP antigen name:Histone H3-like centromeric protein A host organism:Homo sapiens

Mutational analysis of thrombopoietin for identification of receptor and neutralizing antibody sites.

ID: 1776869

Description: epitope description:R99, S108, S115 antigen name:Thrombopoietin host organism:Mus musculus BALB/c antibody name:mAb 1643

A population of autoantibodies against a centromere-associated protein A major epitope motif cross-reacts with related cryptic epitopes on other nucle...

ID: 1776879

Description: epitope description:GGSGPQRRGG antigen name:Epstein-Barr nuclear antigen 1 host organism:Homo sapiens

A population of autoantibodies against a centromere-associated protein A major epitope motif cross-reacts with related cryptic epitopes on other nucle...

ID: 1776882

Description: epitope description:MGPRRRSRKP antigen name:Histone H3-like centromeric protein A host organism:Homo sapiens

Mutational analysis of thrombopoietin for identification of receptor and neutralizing antibody sites.

ID: 1776893

Description: epitope description:K80, Q82, D83, K159 antigen name:Thrombopoietin host organism:Mus musculus BALB/c antibody name:mAb 1831

Immunochemical properties of ubiquitin conjugates in the paired helical filaments of Alzheimer disease.

ID: 1776903

Description: epitope description:LEDGRTLSDYNIQKES antigen name:Polyubiquitin-C (UniProt:P0CG48) host organism:Mus musculus BALB/c antibody name:3-39

Immunochemical properties of ubiquitin conjugates in the paired helical filaments of Alzheimer disease.

ID: 1776905

Description: epitope description:ESTLHLVLRLR antigen name:Polyubiquitin-C (UniProt:P0CG48) host organism:Mus musculus BALB/c antibody name:5-25

Induction of passive Heymann nephritis with antibodies specific for a synthetic peptide derived from the receptor-associated protein.

ID: 1776909

Description: epitope description:HSDLKIQE antigen name:Alpha-2-macroglobulin receptor-associated protein host organism:Oryctolagus cuniculus

Induction of passive Heymann nephritis with antibodies specific for a synthetic peptide derived from the receptor-associated protein.

ID: 1776939

Description: epitope description:SDLKIQE antigen name:Alpha-2-macroglobulin receptor-associated protein host organism:Oryctolagus cuniculus

Induction of passive Heymann nephritis with antibodies specific for a synthetic peptide derived from the receptor-associated protein.

ID: 1776944

Description: epitope description:KAKRLHLSPVRLAELHSDLKIQE antigen name:Alpha-2-macroglobulin receptor-associated protein host organism:Oryctolagus cuniculus

Sequence of protective epitopes of streptococcal M proteins shared with cardiac sarcolemmal membranes.

ID: 1777049

Description: epitope description:KTKNEGLKTENEGLKTENEGLKTENEG antigen name:UniProt:A2RGM0 host organism:Oryctolagus cuniculus New Zealand White

Sequence of protective epitopes of streptococcal M proteins shared with cardiac sarcolemmal membranes.

ID: 1777052

Description: epitope description:DLTKELNKTRQELANKQQESKENEKALNEL antigen name:UniProt:A2RGM0 host organism:Oryctolagus cuniculus New Zealand White

Sequence of protective epitopes of streptococcal M proteins shared with cardiac sarcolemmal membranes.

ID: 1777056

Description: epitope description:TIGTLKKILDETVKDKLAKEQKSKQNIGALKQEL antigen name:UniProt:A2RGM0 host organism:Oryctolagus cuniculus New Zealand White

The human CMV-UL86 peptide 981-1003 shares a crossreactive T-cell epitope with the encephalitogenic MOG peptide 34-56, but lacks the capacity to induc...

ID: 1777089

Description: epitope description:CRISPGKNATGMEVGWYRPPFSR antigen name:Myelin-oligodendrocyte glycoprotein (UniProt:Q16653) host organism:Macaca mulatta

Generation of von Willebrand factor epitope libraries expressed in E. coli.

ID: 1777099

Description: epitope description:CEDSCRSGFTYVLHEGECCGRCLPSACEVVTG antigen name:von Willebrand factor host organism:Mus musculus BALB/c antibody name:MoAb 9

Antigenic structure of histone H2B.

ID: 1777113

Description: epitope description:KVPAPKKGSKKAV antigen name:Histone H2B type 1 host organism:Mus musculus MLR/lpr antibody name:41A5

Antigenic structure of histone H2B.

ID: 1777114

Description: epitope description:GKKRKRSRKE antigen name:Histone H2B type 1 host organism:Mus musculus MLR/lpr antibody name:69B4

An immunodominant epitope on DNA topoisomerase I is conformational in nature: heterogeneity in its recognition by systemic sclerosis sera.

ID: 1777169

Description: epitope description:FDFLGKDSIRYYNKVPVEKRVFKNL antigen name:DNA topoisomerase 1 host organism:Homo sapiens

An immunodominant epitope on DNA topoisomerase I is conformational in nature: heterogeneity in its recognition by systemic sclerosis sera.

ID: 1777171

Description: epitope description:PVEKRVFKNLQLFMENKQPEDDL antigen name:DNA topoisomerase 1 host organism:Homo sapiens

An immunodominant epitope on DNA topoisomerase I is conformational in nature: heterogeneity in its recognition by systemic sclerosis sera.

ID: 1777172

Description: epitope description:KNLQLFMENKQPEDDLFDRLNTG antigen name:DNA topoisomerase 1 host organism:Homo sapiens

Anti-neutrophil cytoplasmic antibodies (ANCA) from patients with systemic vasculitis recognize restricted epitopes of proteinase 3 involving the catal...

ID: 1777174

Description: epitope description:IVGGHEAQPH antigen name:Myeloblastin host organism:Homo sapiens

Anti-neutrophil cytoplasmic antibodies (ANCA) from patients with systemic vasculitis recognize restricted epitopes of proteinase 3 involving the catal...

ID: 1777178

Description: epitope description:SRPYMA antigen name:Myeloblastin host organism:Homo sapiens

Anti-neutrophil cytoplasmic antibodies (ANCA) from patients with systemic vasculitis recognize restricted epitopes of proteinase 3 involving the catal...

ID: 1777183

Description: epitope description:QMRGNPGSHF antigen name:Myeloblastin host organism:Homo sapiens

Anti-neutrophil cytoplasmic antibodies (ANCA) from patients with systemic vasculitis recognize restricted epitopes of proteinase 3 involving the catal...

ID: 1777186

Description: epitope description:GSHFCGGTLI antigen name:Myeloblastin host organism:Homo sapiens

Anti-neutrophil cytoplasmic antibodies (ANCA) from patients with systemic vasculitis recognize restricted epitopes of proteinase 3 involving the catal...

ID: 1777198

Description: epitope description:IPQRLVNVVL antigen name:Myeloblastin host organism:Homo sapiens

Anti-neutrophil cytoplasmic antibodies (ANCA) from patients with systemic vasculitis recognize restricted epitopes of proteinase 3 involving the catal...

ID: 1777204

Description: epitope description:HNVRTQEPTQ antigen name:Myeloblastin host organism:Homo sapiens

Anti-neutrophil cytoplasmic antibodies (ANCA) from patients with systemic vasculitis recognize restricted epitopes of proteinase 3 involving the catal...

ID: 1777210

Description: epitope description:FSVAQVFLNN antigen name:Myeloblastin host organism:Homo sapiens

Anti-neutrophil cytoplasmic antibodies (ANCA) from patients with systemic vasculitis recognize restricted epitopes of proteinase 3 involving the catal...

ID: 1777225

Description: epitope description:LSASVATVQL antigen name:Myeloblastin host organism:Homo sapiens

Anti-neutrophil cytoplasmic antibodies (ANCA) from patients with systemic vasculitis recognize restricted epitopes of proteinase 3 involving the catal...

ID: 1777228

Description: epitope description:TVQLPQQDQP antigen name:Myeloblastin host organism:Homo sapiens

Anti-neutrophil cytoplasmic antibodies (ANCA) from patients with systemic vasculitis recognize restricted epitopes of proteinase 3 involving the catal...

ID: 1777231

Description: epitope description:QDQPVPHGTQ antigen name:Myeloblastin host organism:Homo sapiens

Anti-neutrophil cytoplasmic antibodies (ANCA) from patients with systemic vasculitis recognize restricted epitopes of proteinase 3 involving the catal...

ID: 1777239

Description: epitope description:GRVGAHDPPA antigen name:Myeloblastin host organism:Homo sapiens

Anti-neutrophil cytoplasmic antibodies (ANCA) from patients with systemic vasculitis recognize restricted epitopes of proteinase 3 involving the catal...

ID: 1777241

Description: epitope description:AHDPPAQVLQ antigen name:Myeloblastin host organism:Homo sapiens

Anti-neutrophil cytoplasmic antibodies (ANCA) from patients with systemic vasculitis recognize restricted epitopes of proteinase 3 involving the catal...

ID: 1777249

Description: epitope description:VTFFCRPHNI antigen name:Myeloblastin host organism:Homo sapiens

Anti-neutrophil cytoplasmic antibodies (ANCA) from patients with systemic vasculitis recognize restricted epitopes of proteinase 3 involving the catal...

ID: 1777251

Description: epitope description:CRPHNICTFV antigen name:Myeloblastin host organism:Homo sapiens

Anti-neutrophil cytoplasmic antibodies (ANCA) from patients with systemic vasculitis recognize restricted epitopes of proteinase 3 involving the catal...

ID: 1777252

Description: epitope description:PHNICTFVPR antigen name:Myeloblastin host organism:Homo sapiens

Anti-neutrophil cytoplasmic antibodies (ANCA) from patients with systemic vasculitis recognize restricted epitopes of proteinase 3 involving the catal...

ID: 1777276

Description: epitope description:FFTRVALYVD antigen name:Myeloblastin host organism:Homo sapiens

Anti-neutrophil cytoplasmic antibodies (ANCA) from patients with systemic vasculitis recognize restricted epitopes of proteinase 3 involving the catal...

ID: 1777279

Description: epitope description:LYVDWIRSTL antigen name:Myeloblastin host organism:Homo sapiens

Anti-neutrophil cytoplasmic antibodies (ANCA) from patients with systemic vasculitis recognize restricted epitopes of proteinase 3 involving the catal...

ID: 1777282

Description: epitope description:WIRSTLRRVEAKGRP antigen name:Myeloblastin host organism:Homo sapiens

Evidence that anti-muscarinic antibodies in Sjögren's syndrome recognise both M3R and M1R.

ID: 1777300

Description: epitope description:QYLVGERTVLAGQCYIQFLSQ antigen name:Muscarinic acetylcholine receptor M1 host organism:Oryctolagus cuniculus

Extracellular epitopes of platelet glycoprotein Ib alpha reactive with serum antibodies from patients with chronic idiopathic thrombocytopenic purpura...

ID: 1777303

Description: epitope description:KAMTSNVASVQCDNS antigen name:Platelet glycoprotein Ib alpha chain host organism:Homo sapiens

Extracellular epitopes of platelet glycoprotein Ib alpha reactive with serum antibodies from patients with chronic idiopathic thrombocytopenic purpura...

ID: 1777304

Description: epitope description:KAMTSNVASVQCDNS antigen name:Platelet glycoprotein Ib alpha chain host organism:Homo sapiens

Extracellular epitopes of platelet glycoprotein Ib alpha reactive with serum antibodies from patients with chronic idiopathic thrombocytopenic purpura...

ID: 1777314

Description: epitope description:GKGCPTLGDEGDTDL antigen name:Platelet glycoprotein Ib alpha chain host organism:Homo sapiens

Extracellular epitopes of platelet glycoprotein Ib alpha reactive with serum antibodies from patients with chronic idiopathic thrombocytopenic purpura...

ID: 1777318

Description: epitope description:TDLYDYYPEEDTEGD antigen name:Platelet glycoprotein Ib alpha chain host organism:Homo sapiens

Extracellular epitopes of platelet glycoprotein Ib alpha reactive with serum antibodies from patients with chronic idiopathic thrombocytopenic purpura...

ID: 1777320

Description: epitope description:YPEEDTEGDKVRATR antigen name:Platelet glycoprotein Ib alpha chain host organism:Homo sapiens

Extracellular epitopes of platelet glycoprotein Ib alpha reactive with serum antibodies from patients with chronic idiopathic thrombocytopenic purpura...

ID: 1777322

Description: epitope description:EGDKVRATRTVVKFP antigen name:Platelet glycoprotein Ib alpha chain host organism:Homo sapiens

Extracellular epitopes of platelet glycoprotein Ib alpha reactive with serum antibodies from patients with chronic idiopathic thrombocytopenic purpura...

ID: 1777324

Description: epitope description:ATRTVVKFPTKAHTT antigen name:Platelet glycoprotein Ib alpha chain host organism:Homo sapiens

Extracellular epitopes of platelet glycoprotein Ib alpha reactive with serum antibodies from patients with chronic idiopathic thrombocytopenic purpura...

ID: 1777328

Description: epitope description:HTTPWGLFYSWSTAS antigen name:Platelet glycoprotein Ib alpha chain host organism:Homo sapiens

Extracellular epitopes of platelet glycoprotein Ib alpha reactive with serum antibodies from patients with chronic idiopathic thrombocytopenic purpura...

ID: 1777330

Description: epitope description:LFYSWSTASLDSQMP antigen name:Platelet glycoprotein Ib alpha chain host organism:Homo sapiens

Extracellular epitopes of platelet glycoprotein Ib alpha reactive with serum antibodies from patients with chronic idiopathic thrombocytopenic purpura...

ID: 1777332

Description: epitope description:TASLDSQMPSSLHPT antigen name:Platelet glycoprotein Ib alpha chain host organism:Homo sapiens

Extracellular epitopes of platelet glycoprotein Ib alpha reactive with serum antibodies from patients with chronic idiopathic thrombocytopenic purpura...

ID: 1777334

Description: epitope description:QMPSSLHPTQESTKE antigen name:Platelet glycoprotein Ib alpha chain host organism:Homo sapiens

Extracellular epitopes of platelet glycoprotein Ib alpha reactive with serum antibodies from patients with chronic idiopathic thrombocytopenic purpura...

ID: 1777343

Description: epitope description:PNFTLHMESITFSKT antigen name:Platelet glycoprotein Ib alpha chain host organism:Homo sapiens

Extracellular epitopes of platelet glycoprotein Ib alpha reactive with serum antibodies from patients with chronic idiopathic thrombocytopenic purpura...

ID: 1777345

Description: epitope description:MESITFSKTPKSTTE antigen name:Platelet glycoprotein Ib alpha chain host organism:Homo sapiens

Extracellular epitopes of platelet glycoprotein Ib alpha reactive with serum antibodies from patients with chronic idiopathic thrombocytopenic purpura...

ID: 1777346

Description: epitope description:SKTPKSTTEPTPSPT antigen name:Platelet glycoprotein Ib alpha chain host organism:Homo sapiens

Extracellular epitopes of platelet glycoprotein Ib alpha reactive with serum antibodies from patients with chronic idiopathic thrombocytopenic purpura...

ID: 1777347

Description: epitope description:SKTPKSTTEPTPSPT antigen name:Platelet glycoprotein Ib alpha chain host organism:Homo sapiens

Extracellular epitopes of platelet glycoprotein Ib alpha reactive with serum antibodies from patients with chronic idiopathic thrombocytopenic purpura...

ID: 1777350

Description: epitope description:SPTTSEPVPEPAPNM antigen name:Platelet glycoprotein Ib alpha chain host organism:Homo sapiens

Extracellular epitopes of platelet glycoprotein Ib alpha reactive with serum antibodies from patients with chronic idiopathic thrombocytopenic purpura...

ID: 1777353

Description: epitope description:PVPEPAPNMTTLEPT antigen name:Platelet glycoprotein Ib alpha chain host organism:Homo sapiens

Extracellular epitopes of platelet glycoprotein Ib alpha reactive with serum antibodies from patients with chronic idiopathic thrombocytopenic purpura...

ID: 1777354

Description: epitope description:PNMTTLEPTPSPTTP antigen name:Platelet glycoprotein Ib alpha chain host organism:Homo sapiens

Extracellular epitopes of platelet glycoprotein Ib alpha reactive with serum antibodies from patients with chronic idiopathic thrombocytopenic purpura...

ID: 1777358

Description: epitope description:TTPEPTSEPAPSPTT antigen name:Platelet glycoprotein Ib alpha chain host organism:Homo sapiens

Extracellular epitopes of platelet glycoprotein Ib alpha reactive with serum antibodies from patients with chronic idiopathic thrombocytopenic purpura...

ID: 1777364

Description: epitope description:TPIPTIATSPTILVS antigen name:Platelet glycoprotein Ib alpha chain host organism:Homo sapiens

Extracellular epitopes of platelet glycoprotein Ib alpha reactive with serum antibodies from patients with chronic idiopathic thrombocytopenic purpura...

ID: 1777369

Description: epitope description:LVSATSLITPKSTFL antigen name:Platelet glycoprotein Ib alpha chain host organism:Homo sapiens

Extracellular epitopes of platelet glycoprotein Ib alpha reactive with serum antibodies from patients with chronic idiopathic thrombocytopenic purpura...

ID: 1777371

Description: epitope description:LITPKSTFLTTTKPV antigen name:Platelet glycoprotein Ib alpha chain host organism:Homo sapiens

Extracellular epitopes of platelet glycoprotein Ib alpha reactive with serum antibodies from patients with chronic idiopathic thrombocytopenic purpura...

ID: 1777372

Description: epitope description:TFLTTTKPVSLLEST antigen name:Platelet glycoprotein Ib alpha chain host organism:Homo sapiens

Extracellular epitopes of platelet glycoprotein Ib alpha reactive with serum antibodies from patients with chronic idiopathic thrombocytopenic purpura...

ID: 1777375

Description: epitope description:KPVSLLESTKKTIPE antigen name:Platelet glycoprotein Ib alpha chain host organism:Homo sapiens

Extracellular epitopes of platelet glycoprotein Ib alpha reactive with serum antibodies from patients with chronic idiopathic thrombocytopenic purpura...

ID: 1777383

Description: epitope description:VLQGHLESSRNDPFL antigen name:Platelet glycoprotein Ib alpha chain host organism:Homo sapiens

Structural organization and Zn2+-dependent subdomain interactions involving autoantigenic epitopes in the Ring-B-box-coiled-coil (RBCC) region of Ro52...

ID: 1777393

Description: epitope description:WEEVTCPICLDPFVEPVSIECGHSFCQECISQVGKGGGSVCPVCRQRFL antigen name:E3 ubiquitin-protein ligase TRIM21 host organism:Homo sapiens

Demonstration of the presence of lipid peroxide-modified proteins in human atherosclerotic lesions using a novel lipid peroxide-modified anti-peptide ...

ID: 1777400

Description: epitope description:KKVLGEKTENPKKFK antigen name:Other Homo sapiens (human) protein host organism:Oryctolagus cuniculus

Demonstration of the presence of lipid peroxide-modified proteins in human atherosclerotic lesions using a novel lipid peroxide-modified anti-peptide ...

ID: 1777401

Description: epitope description:KKVLGEKTENPKKFK antigen name:Other Homo sapiens (human) protein host organism:Gallus gallus

Renal autoimmune epitope of group A streptococci specified by M protein tetrapeptide Ile-Arg-Leu-Arg.

ID: 1777412

Description: epitope description:NGDGNPREVIEDLAANNPAIQNIRLR + CYSTL(R26) antigen name:UniProt:A2RGM0 host organism:Oryctolagus cuniculus New Zealand White

Renal autoimmune epitope of group A streptococci specified by M protein tetrapeptide Ile-Arg-Leu-Arg.

ID: 1777413

Description: epitope description:NGDGNPREVIEDLAANNPAIQNIRLR + CYSTL(R26) antigen name:UniProt:A2RGM0 host organism:Oryctolagus cuniculus New Zealand White

Renal autoimmune epitope of group A streptococci specified by M protein tetrapeptide Ile-Arg-Leu-Arg.

ID: 1777418

Description: epitope description:NGDGNPREVIEDLAANNPAIQNI + CYSTL(I23) antigen name:UniProt:A2RGM0 host organism:Oryctolagus cuniculus New Zealand White

Renal autoimmune epitope of group A streptococci specified by M protein tetrapeptide Ile-Arg-Leu-Arg.

ID: 1777433

Description: epitope description:RHENKDLKARLENAME + CYSTL(E16) antigen name:UniProt:A2RGM0 host organism:Oryctolagus cuniculus New Zealand White

Renal autoimmune epitope of group A streptococci specified by M protein tetrapeptide Ile-Arg-Leu-Arg.

ID: 1777434

Description: epitope description:RHENKDLKARLENAME + CYSTL(E16) antigen name:UniProt:A2RGM0 host organism:Oryctolagus cuniculus New Zealand White

Renal autoimmune epitope of group A streptococci specified by M protein tetrapeptide Ile-Arg-Leu-Arg.

ID: 1777435

Description: epitope description:RHENKDLKARLENAME + CYSTL(E16) antigen name:UniProt:A2RGM0 host organism:Oryctolagus cuniculus New Zealand White

Renal autoimmune epitope of group A streptococci specified by M protein tetrapeptide Ile-Arg-Leu-Arg.

ID: 1777444

Description: epitope description:AIQNIRLRHENKDL + CYSTL(L14) antigen name:UniProt:A2RGM0 host organism:Oryctolagus cuniculus New Zealand White

Renal autoimmune epitope of group A streptococci specified by M protein tetrapeptide Ile-Arg-Leu-Arg.

ID: 1777449

Description: epitope description:IRLR + CYSTL(R4) antigen name:UniProt:A2RGM0 host organism:Oryctolagus cuniculus New Zealand White

Evidence that anti-muscarinic antibodies in Sjögren's syndrome recognise both M3R and M1R.

ID: 1777454

Description: epitope description:QYLVGERTVLAGQCYIQFLSQ antigen name:Muscarinic acetylcholine receptor M1 host organism:Homo sapiens

Evidence that anti-muscarinic antibodies in Sjögren's syndrome recognise both M3R and M1R.

ID: 1777466

Description: epitope description:QYFVGKRTVPPGECFIQFLSE antigen name:Muscarinic acetylcholine receptor M3 host organism:Homo sapiens

Evidence that anti-muscarinic antibodies in Sjögren's syndrome recognise both M3R and M1R.

ID: 1777503

Description: epitope description:QYFVGKRTVPPGECFIQFLSEPTITFGTAI antigen name:Muscarinic acetylcholine receptor M3 host organism:Homo sapiens

Evidence that anti-muscarinic antibodies in Sjögren's syndrome recognise both M3R and M1R.

ID: 1777507

Description: epitope description:QYFVGKRTVPPGECFIQFLSEPTITFGTAI antigen name:Muscarinic acetylcholine receptor M3 host organism:Homo sapiens

Cross-reactive epitope with Klebsiella pneumoniae nitrogenase in articular tissue of HLA-B27+ patients with ankylosing spondylitis.

ID: 1777521

Description: epitope description:CNSRQTDREDELI antigen name:Other Klebsiella pneumoniae protein host organism:Rattus norvegicus

Cross-reactive epitope with Klebsiella pneumoniae nitrogenase in articular tissue of HLA-B27+ patients with ankylosing spondylitis.

ID: 1777522

Description: epitope description:CNSRQTDREDELI antigen name:Other Klebsiella pneumoniae protein host organism:Rattus norvegicus

Cross-reactive epitope with Klebsiella pneumoniae nitrogenase in articular tissue of HLA-B27+ patients with ankylosing spondylitis.

ID: 1777533

Description: epitope description:KAKAQTDREDLRTLLR antigen name:HLA class I histocompatibility antigen, B-27 alpha chain host organism:Rattus norvegicus

Hierarchical self-tolerance to T cell determinants within the ubiquitous nuclear self-antigen La (SS-B) permits induction of systemic autoimmunity in ...

ID: 1777550

Description: epitope description:DANNGNLQLRNKEVT antigen name:Lupus La protein host organism:Mus musculus A/J

Hierarchical self-tolerance to T cell determinants within the ubiquitous nuclear self-antigen La (SS-B) permits induction of systemic autoimmunity in ...

ID: 1777551

Description: epitope description:NANNGNLLLRNKKVT antigen name:Lupus La protein homolog host organism:Mus musculus A/J

Hierarchical self-tolerance to T cell determinants within the ubiquitous nuclear self-antigen La (SS-B) permits induction of systemic autoimmunity in ...

ID: 1777557

Description: epitope description:LEAKICHQIEYYFGDFNL antigen name:Lupus La protein homolog host organism:Mus musculus A/J

Hierarchical self-tolerance to T cell determinants within the ubiquitous nuclear self-antigen La (SS-B) permits induction of systemic autoimmunity in ...

ID: 1777561

Description: epitope description:NDVKNRSVYIKGFPTDATLDDIKE antigen name:Lupus La protein homolog host organism:Mus musculus A/J

Hierarchical self-tolerance to T cell determinants within the ubiquitous nuclear self-antigen La (SS-B) permits induction of systemic autoimmunity in ...

ID: 1777565

Description: epitope description:NANNGNLLLRNKKVT antigen name:Lupus La protein homolog host organism:Mus musculus A/J

Hierarchical self-tolerance to T cell determinants within the ubiquitous nuclear self-antigen La (SS-B) permits induction of systemic autoimmunity in ...

ID: 1777568

Description: epitope description:LEAKICHQIEYYFGDFNL antigen name:Lupus La protein homolog host organism:Mus musculus A/J

Atomic-level mapping of antibody epitopes on a GPCR.

ID: 1777615

Description: epitope description:Y10, D11, I12, N13, Y15 antigen name:C-C chemokine receptor type 5 host organism:Mus musculus antibody name:CTC8

Atomic-level mapping of antibody epitopes on a GPCR.

ID: 1777619

Description: epitope description:I36, F38, K43, E44, W62 antigen name:C-C chemokine receptor type 5 host organism:Mus musculus antibody name:45533

Atomic-level mapping of antibody epitopes on a GPCR.

ID: 1777620

Description: epitope description:K43, E44 antigen name:C-C chemokine receptor type 5 host organism:Mus musculus antibody name:2D7

Fine specificity mapping of autoantigens targeted by anti-centromere autoantibodies.

ID: 1777648

Description: epitope description:PRRRSRKPEA antigen name:Histone H3-like centromeric protein A host organism:Homo sapiens

Fine specificity mapping of autoantigens targeted by anti-centromere autoantibodies.

ID: 1777653

Description: epitope description:PRRRSPSPTP antigen name:Histone H3-like centromeric protein A host organism:Homo sapiens

Fine specificity mapping of autoantigens targeted by anti-centromere autoantibodies.

ID: 1777658

Description: epitope description:TPGPSRRGPS antigen name:Histone H3-like centromeric protein A host organism:Homo sapiens

Fine specificity mapping of autoantigens targeted by anti-centromere autoantibodies.

ID: 1777659

Description: epitope description:GPSRRGPSLG antigen name:Histone H3-like centromeric protein A host organism:Homo sapiens