Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Characterization of the epitope of anti-lipoarabinomannan antibodies as the terminal hexaarabinofuranosyl motif of mycobacterial arabinans.

    ID: 1327533

    Description: epitope description:beta-D-Araf-(1->2)-alpha-D-Araf-(1->5)-[beta-D-Araf-(1->2)-alpha-D-Araf-(1->3)]-alpha-D-Araf-(1->5)-alpha-D-Araf-yl group antigen ...

    Publication: 12368438;

  2. Disease-associated prion protein elicits immunoglobulin M responses in vivo.

    ID: 1327577

    Description: epitope description:GGGTHNQWNKPSKPKTNLKH antigen name:Major prion protein host organism:Mus musculus FVB/N Prp null antibody name:anti-(heat-treated)P...

    Publication: 15706401;

  3. Disease-associated prion protein elicits immunoglobulin M responses in vivo.

    ID: 1327578

    Description: epitope description:GGGTHNQWNKPSKPKTNLKH antigen name:Major prion protein host organism:Mus musculus FVB/N Prp null antibody name:anti-PrPc

    Publication: 15706401;

  4. Disease-associated prion protein elicits immunoglobulin M responses in vivo.

    ID: 1327588

    Description: epitope description:SAMSRPMIHFGNDWEDRYYR antigen name:Major prion protein host organism:Mus musculus FVB/N Prp null antibody name:anti-PrPc

    Publication: 15706401;

  5. Disease-associated prion protein elicits immunoglobulin M responses in vivo.

    ID: 1327592

    Description: epitope description:GNDWEDRYYRENMYRYPNQV antigen name:Major prion protein host organism:Mus musculus FVB/N Prp null antibody name:anti-PrPc

    Publication: 15706401;

  6. Disease-associated prion protein elicits immunoglobulin M responses in vivo.

    ID: 1327597

    Description: epitope description:YYRPVDQYSNQNNFVHDCVN antigen name:Major prion protein host organism:Mus musculus FVB/N Prp null antibody name:anti-PrPc

    Publication: 15706401;

  7. Disease-associated prion protein elicits immunoglobulin M responses in vivo.

    ID: 1327611

    Description: epitope description:DVKMMERVVEQMCVTQYQKE antigen name:Major prion protein host organism:Mus musculus FVB/N Prp null antibody name:anti-(heat-treated)P...

    Publication: 15706401;

  8. Disease-associated prion protein elicits immunoglobulin M responses in vivo.

    ID: 1327615

    Description: epitope description:GGGTHNQWNKPSKPKTNLKH antigen name:Major prion protein host organism:Mus musculus FVB/N Prp null antibody name:ICSM 35

    Publication: 15706401;

  9. Immunodominant B-cell domains of hepatitis C virus envelope proteins E1 and E2 identified during early and late time points of infection.

    ID: 1327652

    Description: epitope description:YHVTNDCPNSSIVYEAADAI antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10068093;

  10. Immunodominant B-cell domains of hepatitis C virus envelope proteins E1 and E2 identified during early and late time points of infection.

    ID: 1327657

    Description: epitope description:SIVYEAADAILHTPGCVPCV antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10068093;

  11. Immunodominant B-cell domains of hepatitis C virus envelope proteins E1 and E2 identified during early and late time points of infection.

    ID: 1327659

    Description: epitope description:LHTPGCVPCVREGNASRCWV antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10068093;

  12. Immunodominant B-cell domains of hepatitis C virus envelope proteins E1 and E2 identified during early and late time points of infection.

    ID: 1327661

    Description: epitope description:LHTPGCVPCVREGNASRCWV antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10068093;

  13. Immunodominant B-cell domains of hepatitis C virus envelope proteins E1 and E2 identified during early and late time points of infection.

    ID: 1327662

    Description: epitope description:REGNASRCWVAMTPTVATRD antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10068093;

  14. Immunodominant B-cell domains of hepatitis C virus envelope proteins E1 and E2 identified during early and late time points of infection.

    ID: 1327664

    Description: epitope description:REGNASRCWVAMTPTVATRD antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10068093;

  15. Immunodominant B-cell domains of hepatitis C virus envelope proteins E1 and E2 identified during early and late time points of infection.

    ID: 1327669

    Description: epitope description:AMTPTVATRDGKLPATQLRR antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10068093;

  16. Immunodominant B-cell domains of hepatitis C virus envelope proteins E1 and E2 identified during early and late time points of infection.

    ID: 1327670

    Description: epitope description:GKLPATQLRRHIDLLVGSAT antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10068093;

  17. Immunodominant B-cell domains of hepatitis C virus envelope proteins E1 and E2 identified during early and late time points of infection.

    ID: 1327674

    Description: epitope description:HIDLLVGSATLCSALYVGDL antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10068093;

  18. Immunodominant B-cell domains of hepatitis C virus envelope proteins E1 and E2 identified during early and late time points of infection.

    ID: 1327707

    Description: epitope description:PQAILDMIAGAHWGVLAGIA antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10068093;

  19. Immunodominant B-cell domains of hepatitis C virus envelope proteins E1 and E2 identified during early and late time points of infection.

    ID: 1327712

    Description: epitope description:AHWGVLAGIAYFSMVGNWAK antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10068093;

  20. Immunodominant B-cell domains of hepatitis C virus envelope proteins E1 and E2 identified during early and late time points of infection.

    ID: 1327714

    Description: epitope description:YFSMVGNWAKVLVVLLLFAG antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10068093;

  21. Immunodominant B-cell domains of hepatitis C virus envelope proteins E1 and E2 identified during early and late time points of infection.

    ID: 1327716

    Description: epitope description:YFSMVGNWAKVLVVLLLFAG antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10068093;

  22. Immunodominant B-cell domains of hepatitis C virus envelope proteins E1 and E2 identified during early and late time points of infection.

    ID: 1327720

    Description: epitope description:VLVVLLLFAGVDAETH antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10068093;

  23. Immunodominant B-cell domains of hepatitis C virus envelope proteins E1 and E2 identified during early and late time points of infection.

    ID: 1327723

    Description: epitope description:VQLINTNGSWHLNSTALNCN antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10068093;

  24. Immunodominant B-cell domains of hepatitis C virus envelope proteins E1 and E2 identified during early and late time points of infection.

    ID: 1327726

    Description: epitope description:HLNSTALNCNDSLNTGWLAG antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10068093;

  25. Immunodominant B-cell domains of hepatitis C virus envelope proteins E1 and E2 identified during early and late time points of infection.

    ID: 1327729

    Description: epitope description:HLNSTALNCNDSLNTGWLAG antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10068093;

  26. Immunodominant B-cell domains of hepatitis C virus envelope proteins E1 and E2 identified during early and late time points of infection.

    ID: 1327740

    Description: epitope description:GCPERLASCRPLTDFDQGWG antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10068093;

  27. Immunodominant B-cell domains of hepatitis C virus envelope proteins E1 and E2 identified during early and late time points of infection.

    ID: 1327741

    Description: epitope description:GCPERLASCRPLTDFDQGWG antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10068093;

  28. Immunodominant B-cell domains of hepatitis C virus envelope proteins E1 and E2 identified during early and late time points of infection.

    ID: 1327745

    Description: epitope description:PLTDFDQGWGPISYANGSGP antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10068093;

  29. Immunodominant B-cell domains of hepatitis C virus envelope proteins E1 and E2 identified during early and late time points of infection.

    ID: 1327746

    Description: epitope description:PISYANGSGPDQRPYCWHY antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10068093;

  30. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328149

    Description: epitope description:VASRRRPTTAGAAPLTAVAPAHDTPPVPDV antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  31. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328157

    Description: epitope description:DTPPVPDVDSRGAILRRQYNLSTSPLTSSV antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  32. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328161

    Description: epitope description:ARATIRYRPLVPNAVGGYAISISFWPQTTT antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  33. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328166

    Description: epitope description:SVDMNSITSTDVRILVQPGIASELVIPSER antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  34. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328171

    Description: epitope description:VIPSERLHYRNQGWRSVETSGVAEEEATSG antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  35. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328176

    Description: epitope description:GSPVNSYTNTPYTGALGLLDFALELEFRNL antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  36. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328178

    Description: epitope description:DFALELEFRNLTPGNTNTRVSRYSSTARHR antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  37. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328193

    Description: epitope description:DYDNQHEQDRPTPSPAPSRPFSVLRANDVL antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  38. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328194

    Description: epitope description:DRPTPSPAPSRPFSVLRANDVLWLSLTAAE antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  39. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328195

    Description: epitope description:APSRPFSVLRANDVLWLSLTAAEYDQSTYG antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  40. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328197

    Description: epitope description:NAAGHRVAISTYTTSLGAGPVSISAVAVLA antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  41. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328200

    Description: epitope description:LAPHSALALLEDTMDYPARAHTFDDFCPEC antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  42. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328207

    Description: epitope description:GSPVNSYTNTPYTGALGLLDFALELEFRNL antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  43. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328211

    Description: epitope description:GNTNTRVSRYSSTARHRLRRGADGTAELTT antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  44. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328225

    Description: epitope description:RANDVLWLSLTAAEYDQSTYGSSTGPVYVS antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  45. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328227

    Description: epitope description:STYGSSTGPVYVSDSVTLVNVATGAQAVAR antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  46. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328229

    Description: epitope description:VLPLRGKLSFWEAGTTKAGYPYNYNTTASD antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  47. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328233

    Description: epitope description:LAPHSALALLEDTMDYPARAHTFDDFCPEC antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  48. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328234

    Description: epitope description:LEDTMDYPARAHTFDDFCPECRPLGLQGCA antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  49. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328235

    Description: epitope description:DYPARAHTFDDFCPECRPLGLQGCAFQSTV antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  50. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328237

    Description: epitope description:FCPECRPLGLQGCAFQSTVAELQRLKMKVG antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston