Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 100 of 1,510,353 results for " "

  1. Fine specificity mapping of autoantigens targeted by anti-centromere autoantibodies.

    ID: 1777660

    Description: epitope description:SRRGPSLGAS antigen name:Histone H3-like centromeric protein A host organism:Homo sapiens

    Publication: 17210244;

  2. Immune responses to self peptides naturally presented by murine class II major histocompatibility complex molecules.

    ID: 1773173

    Description: epitope description:VPQLNQMVRTAAEVAGQ antigen name:Transferrin receptor protein 1 host organism:Mus musculus BALB/c

    Publication: 8760274;

  3. Determination of thrombopoietin-derived peptides recognized by both cellular and humoral immunities in healthy donors and patients with thrombocytopen...

    ID: 1773230

    Description: epitope description:KLLRDSHVL antigen name:Thrombopoietin host organism:Homo sapiens

    Publication: 16043461;

  4. Determination of thrombopoietin-derived peptides recognized by both cellular and humoral immunities in healthy donors and patients with thrombocytopen...

    ID: 1773231

    Description: epitope description:KLLRDSHVL antigen name:Thrombopoietin host organism:Homo sapiens

    Publication: 16043461;

  5. Determination of thrombopoietin-derived peptides recognized by both cellular and humoral immunities in healthy donors and patients with thrombocytopen...

    ID: 1773233

    Description: epitope description:VLLPAVDFSL antigen name:Thrombopoietin host organism:Homo sapiens

    Publication: 16043461;

  6. Determination of thrombopoietin-derived peptides recognized by both cellular and humoral immunities in healthy donors and patients with thrombocytopen...

    ID: 1773243

    Description: epitope description:TLLLEGVMAA antigen name:Thrombopoietin host organism:Homo sapiens

    Publication: 16043461;

  7. Determination of thrombopoietin-derived peptides recognized by both cellular and humoral immunities in healthy donors and patients with thrombocytopen...

    ID: 1773247

    Description: epitope description:LLLEGVMAA antigen name:Thrombopoietin host organism:Homo sapiens

    Publication: 16043461;

  8. Determination of thrombopoietin-derived peptides recognized by both cellular and humoral immunities in healthy donors and patients with thrombocytopen...

    ID: 1773251

    Description: epitope description:GVMAARGQL antigen name:Thrombopoietin host organism:Homo sapiens

    Publication: 16043461;

  9. Determination of thrombopoietin-derived peptides recognized by both cellular and humoral immunities in healthy donors and patients with thrombocytopen...

    ID: 1773254

    Description: epitope description:QLGPTCLSSL antigen name:Thrombopoietin host organism:Homo sapiens

    Publication: 16043461;

  10. Determination of thrombopoietin-derived peptides recognized by both cellular and humoral immunities in healthy donors and patients with thrombocytopen...

    ID: 1773255

    Description: epitope description:QLGPTCLSSL antigen name:Thrombopoietin host organism:Homo sapiens

    Publication: 16043461;

  11. Determination of thrombopoietin-derived peptides recognized by both cellular and humoral immunities in healthy donors and patients with thrombocytopen...

    ID: 1773262

    Description: epitope description:AIFLSFQHLL antigen name:Thrombopoietin host organism:Homo sapiens

    Publication: 16043461;

  12. Determination of thrombopoietin-derived peptides recognized by both cellular and humoral immunities in healthy donors and patients with thrombocytopen...

    ID: 1773263

    Description: epitope description:AIFLSFQHLL antigen name:Thrombopoietin host organism:Homo sapiens

    Publication: 16043461;

  13. Determination of thrombopoietin-derived peptides recognized by both cellular and humoral immunities in healthy donors and patients with thrombocytopen...

    ID: 1773264

    Description: epitope description:AIFLSFQHLL antigen name:Thrombopoietin host organism:Homo sapiens

    Publication: 16043461;

  14. Determination of thrombopoietin-derived peptides recognized by both cellular and humoral immunities in healthy donors and patients with thrombocytopen...

    ID: 1773266

    Description: epitope description:FLMLVGGSTL antigen name:Thrombopoietin host organism:Homo sapiens

    Publication: 16043461;

  15. Determination of thrombopoietin-derived peptides recognized by both cellular and humoral immunities in healthy donors and patients with thrombocytopen...

    ID: 1773268

    Description: epitope description:FLMLVGGSTL antigen name:Thrombopoietin host organism:Homo sapiens

    Publication: 16043461;

  16. Determination of thrombopoietin-derived peptides recognized by both cellular and humoral immunities in healthy donors and patients with thrombocytopen...

    ID: 1773272

    Description: epitope description:MLVGGSTLCV antigen name:Thrombopoietin host organism:Homo sapiens

    Publication: 16043461;

  17. Determination of thrombopoietin-derived peptides recognized by both cellular and humoral immunities in healthy donors and patients with thrombocytopen...

    ID: 1773273

    Description: epitope description:SLVLTLNEL antigen name:Thrombopoietin host organism:Homo sapiens

    Publication: 16043461;

  18. Determination of thrombopoietin-derived peptides recognized by both cellular and humoral immunities in healthy donors and patients with thrombocytopen...

    ID: 1773281

    Description: epitope description:GLLETNFTA antigen name:Thrombopoietin host organism:Homo sapiens

    Publication: 16043461;

  19. Determination of thrombopoietin-derived peptides recognized by both cellular and humoral immunities in healthy donors and patients with thrombocytopen...

    ID: 1773283

    Description: epitope description:GLLETNFTA antigen name:Thrombopoietin host organism:Homo sapiens

    Publication: 16043461;

  20. Determination of thrombopoietin-derived peptides recognized by both cellular and humoral immunities in healthy donors and patients with thrombocytopen...

    ID: 1773284

    Description: epitope description:GLLETNFTA antigen name:Thrombopoietin host organism:Homo sapiens

    Publication: 16043461;

  21. Determination of thrombopoietin-derived peptides recognized by both cellular and humoral immunities in healthy donors and patients with thrombocytopen...

    ID: 1773295

    Description: epitope description:TLPTPVVQL antigen name:Thrombopoietin host organism:Homo sapiens

    Publication: 16043461;

  22. Autoreactive antibodies are present in sheep with Johne's disease and cross-react with Mycobacterium avium subsp. paratuberculosis antigens.

    ID: 1773314

    Description: epitope description:KSLSRHDHIHHH host organism:Ovis aries

    Publication: 17544799;

  23. Autoreactive antibodies are present in sheep with Johne's disease and cross-react with Mycobacterium avium subsp. paratuberculosis antigens.

    ID: 1773318

    Description: epitope description:KSLSRHDHIHHH host organism:Ovis aries

    Publication: 17544799;

  24. Autoreactive antibodies are present in sheep with Johne's disease and cross-react with Mycobacterium avium subsp. paratuberculosis antigens.

    ID: 1773319

    Description: epitope description:KSLSRHDHIHHH host organism:Ovis aries

    Publication: 17544799;

  25. Multimerization of peptide mimotopes for blocking of factor VIII neutralizing antibodies.

    ID: 1773320

    Description: epitope description:NPVENMMDRDSQ host organism:Homo sapiens antibody name:Patient sera

    Publication: 19533722;

  26. Crystal structure of human prion protein bound to a therapeutic antibody.

    ID: 1773336

    Description: epitope description:S143, D144, Y145, R148 R151, E152, K204 antigen name:Major prion protein host organism:Mus musculus PrP null antibody name:ICSM 18

    Publication: 19204296;

  27. Crystal structure of human prion protein bound to a therapeutic antibody.

    ID: 1773343

    Description: epitope description:S143, D144, Y145, R148 R151, E152, K204 antigen name:Major prion protein host organism:Mus musculus PrP null antibody name:ICSM 18

    Publication: 19204296;

  28. Conversion of human choriogonadotropin into a follitropin by protein engineering.

    ID: 1773344

    Description: epitope description:YTRDLVYKNPARPKIQKTCT antigen name:Follicle-stimulating hormone receptor host organism:Mus musculus antibody name:B601

    Publication: 1899483;

  29. Crystal structure of human prion protein bound to a therapeutic antibody.

    ID: 1773352

    Description: epitope description:QGGGTHSQWNKPSKPKTNMK antigen name:Major prion protein host organism:Mus musculus PrP null antibody name:ICSM 33

    Publication: 19204296;

  30. Multimerization of peptide mimotopes for blocking of factor VIII neutralizing antibodies.

    ID: 1773396

    Description: epitope description:NPVENMMDRDSQ host organism:Homo sapiens antibody name:Patient sera

    Publication: 19533722;

  31. Evidence for two discontinuous regions on the thyrotropin receptor involved in the binding of the monoclonal antibody 34A.

    ID: 1773406

    Description: epitope description:GQELKNPQ antigen name:Thyrotropin receptor host organism:Mus musculus DBA/1 antibody name:12E3

    Publication: 15671578;

  32. Evidence for two discontinuous regions on the thyrotropin receptor involved in the binding of the monoclonal antibody 34A.

    ID: 1773413

    Description: epitope description:TCSADGRTLFYNLCL host organism:Mus musculus DBA/1 antibody name:34A

    Publication: 15671578;

  33. Evidence for two discontinuous regions on the thyrotropin receptor involved in the binding of the monoclonal antibody 34A.

    ID: 1773414

    Description: epitope description:TCSADGRTLFYNLCL host organism:Mus musculus DBA/1 antibody name:34A

    Publication: 15671578;

  34. Evidence for two discontinuous regions on the thyrotropin receptor involved in the binding of the monoclonal antibody 34A.

    ID: 1773415

    Description: epitope description:TWSADGGTLFCNMCH host organism:Mus musculus DBA/1 antibody name:34A

    Publication: 15671578;

  35. Evidence for two discontinuous regions on the thyrotropin receptor involved in the binding of the monoclonal antibody 34A.

    ID: 1773426

    Description: epitope description:KHRPHGYNSLVNTQV host organism:Mus musculus DBA/1 antibody name:34A

    Publication: 15671578;

  36. Evidence for two discontinuous regions on the thyrotropin receptor involved in the binding of the monoclonal antibody 34A.

    ID: 1773437

    Description: epitope description:RTDDKMRMHSHLSHH host organism:Homo sapiens

    Publication: 15671578;

  37. Mapping of B cell epitopes on steroid 17 alpha-hydroxylase, an autoantigen in autoimmune polyglandular syndrome type I.

    ID: 1773461

    Description: epitope description:ITNMLDTLMQA antigen name:Steroid 17-alpha-hydroxylase/17,20 lyase host organism:Homo sapiens

    Publication: 7523005;

  38. Epitope mapping of ADAMTS13 autoantibodies in acquired thrombotic thrombocytopenic purpura.

    ID: 1773485

    Description: epitope description:PSHFQQSCLQALEPQAVSSYLSPGAPLKGRPPSPGFQRQRQRQRR antigen name:A disintegrin and metalloproteinase with thrombospondin motifs 13 host ...

    Publication: 14976043;

  39. Early targets of nuclear RNP humoral autoimmunity in human systemic lupus erythematosus.

    ID: 1773605

    Description: epitope description:TRPNHTIY antigen name:U1 small nuclear ribonucleoprotein A host organism:Homo sapiens

    Publication: 19248110;

  40. Early targets of nuclear RNP humoral autoimmunity in human systemic lupus erythematosus.

    ID: 1773611

    Description: epitope description:IYINNLNE antigen name:U1 small nuclear ribonucleoprotein A host organism:Homo sapiens

    Publication: 19248110;

  41. Early targets of nuclear RNP humoral autoimmunity in human systemic lupus erythematosus.

    ID: 1773612

    Description: epitope description:YINNLNEK antigen name:U1 small nuclear ribonucleoprotein A host organism:Homo sapiens

    Publication: 19248110;

  42. Early targets of nuclear RNP humoral autoimmunity in human systemic lupus erythematosus.

    ID: 1773614

    Description: epitope description:NNLNEKIK antigen name:U1 small nuclear ribonucleoprotein A host organism:Homo sapiens

    Publication: 19248110;

  43. Early targets of nuclear RNP humoral autoimmunity in human systemic lupus erythematosus.

    ID: 1773619

    Description: epitope description:KIKKDELK antigen name:U1 small nuclear ribonucleoprotein A host organism:Homo sapiens

    Publication: 19248110;

  44. Early targets of nuclear RNP humoral autoimmunity in human systemic lupus erythematosus.

    ID: 1773623

    Description: epitope description:DELKKSLY antigen name:U1 small nuclear ribonucleoprotein A host organism:Homo sapiens

    Publication: 19248110;

  45. Early targets of nuclear RNP humoral autoimmunity in human systemic lupus erythematosus.

    ID: 1773625

    Description: epitope description:LKKSLYAI antigen name:U1 small nuclear ribonucleoprotein A host organism:Homo sapiens

    Publication: 19248110;

  46. Early targets of nuclear RNP humoral autoimmunity in human systemic lupus erythematosus.

    ID: 1773627

    Description: epitope description:KSLYAIFS antigen name:U1 small nuclear ribonucleoprotein A host organism:Homo sapiens

    Publication: 19248110;

  47. Early targets of nuclear RNP humoral autoimmunity in human systemic lupus erythematosus.

    ID: 1773629

    Description: epitope description:LYAIFSQF antigen name:U1 small nuclear ribonucleoprotein A host organism:Homo sapiens

    Publication: 19248110;

  48. Early targets of nuclear RNP humoral autoimmunity in human systemic lupus erythematosus.

    ID: 1773631

    Description: epitope description:AIFSQFGQ antigen name:U1 small nuclear ribonucleoprotein A host organism:Homo sapiens

    Publication: 19248110;

  49. Early targets of nuclear RNP humoral autoimmunity in human systemic lupus erythematosus.

    ID: 1773632

    Description: epitope description:IFSQFGQI antigen name:U1 small nuclear ribonucleoprotein A host organism:Homo sapiens

    Publication: 19248110;

  50. Early targets of nuclear RNP humoral autoimmunity in human systemic lupus erythematosus.

    ID: 1773644

    Description: epitope description:VSRSLKMR antigen name:U1 small nuclear ribonucleoprotein A host organism:Homo sapiens

    Publication: 19248110;

  51. Early targets of nuclear RNP humoral autoimmunity in human systemic lupus erythematosus.

    ID: 1773650

    Description: epitope description:MRGQAFVI antigen name:U1 small nuclear ribonucleoprotein A host organism:Homo sapiens

    Publication: 19248110;

  52. Early targets of nuclear RNP humoral autoimmunity in human systemic lupus erythematosus.

    ID: 1773651

    Description: epitope description:RGQAFVIF antigen name:U1 small nuclear ribonucleoprotein A host organism:Homo sapiens

    Publication: 19248110;

  53. Early targets of nuclear RNP humoral autoimmunity in human systemic lupus erythematosus.

    ID: 1773652

    Description: epitope description:GQAFVIFK antigen name:U1 small nuclear ribonucleoprotein A host organism:Homo sapiens

    Publication: 19248110;

  54. Early targets of nuclear RNP humoral autoimmunity in human systemic lupus erythematosus.

    ID: 1773655

    Description: epitope description:FVIFKEVS antigen name:U1 small nuclear ribonucleoprotein A host organism:Homo sapiens

    Publication: 19248110;

  55. Early targets of nuclear RNP humoral autoimmunity in human systemic lupus erythematosus.

    ID: 1773656

    Description: epitope description:VIFKEVSS antigen name:U1 small nuclear ribonucleoprotein A host organism:Homo sapiens

    Publication: 19248110;

  56. Early targets of nuclear RNP humoral autoimmunity in human systemic lupus erythematosus.

    ID: 1773658

    Description: epitope description:FKEVSSAT antigen name:U1 small nuclear ribonucleoprotein A host organism:Homo sapiens

    Publication: 19248110;

  57. Early targets of nuclear RNP humoral autoimmunity in human systemic lupus erythematosus.

    ID: 1773664

    Description: epitope description:ATNALRSM antigen name:U1 small nuclear ribonucleoprotein A host organism:Homo sapiens

    Publication: 19248110;

  58. Early targets of nuclear RNP humoral autoimmunity in human systemic lupus erythematosus.

    ID: 1773665

    Description: epitope description:TNALRSMQ antigen name:U1 small nuclear ribonucleoprotein A host organism:Homo sapiens

    Publication: 19248110;

  59. Early targets of nuclear RNP humoral autoimmunity in human systemic lupus erythematosus.

    ID: 1773682

    Description: epitope description:RIQYAKTD antigen name:U1 small nuclear ribonucleoprotein A host organism:Homo sapiens

    Publication: 19248110;

  60. Early targets of nuclear RNP humoral autoimmunity in human systemic lupus erythematosus.

    ID: 1773690

    Description: epitope description:SDIIAKMK antigen name:U1 small nuclear ribonucleoprotein A host organism:Homo sapiens

    Publication: 19248110;

  61. Early targets of nuclear RNP humoral autoimmunity in human systemic lupus erythematosus.

    ID: 1773693

    Description: epitope description:IAKMKGTF antigen name:U1 small nuclear ribonucleoprotein A host organism:Homo sapiens

    Publication: 19248110;

  62. Early targets of nuclear RNP humoral autoimmunity in human systemic lupus erythematosus.

    ID: 1773695

    Description: epitope description:KMKGTFVE antigen name:U1 small nuclear ribonucleoprotein A host organism:Homo sapiens

    Publication: 19248110;

  63. Early targets of nuclear RNP humoral autoimmunity in human systemic lupus erythematosus.

    ID: 1773696

    Description: epitope description:MKGTFVER antigen name:U1 small nuclear ribonucleoprotein A host organism:Homo sapiens

    Publication: 19248110;

  64. Early targets of nuclear RNP humoral autoimmunity in human systemic lupus erythematosus.

    ID: 1773709

    Description: epitope description:KRKPKSQE antigen name:U1 small nuclear ribonucleoprotein A host organism:Homo sapiens

    Publication: 19248110;

  65. Early targets of nuclear RNP humoral autoimmunity in human systemic lupus erythematosus.

    ID: 1773711

    Description: epitope description:KPKSQETP antigen name:U1 small nuclear ribonucleoprotein A host organism:Homo sapiens

    Publication: 19248110;

  66. Early targets of nuclear RNP humoral autoimmunity in human systemic lupus erythematosus.

    ID: 1773713

    Description: epitope description:KSQETPAT antigen name:U1 small nuclear ribonucleoprotein A host organism:Homo sapiens

    Publication: 19248110;

  67. Early targets of nuclear RNP humoral autoimmunity in human systemic lupus erythematosus.

    ID: 1773714

    Description: epitope description:SQETPATK antigen name:U1 small nuclear ribonucleoprotein A host organism:Homo sapiens

    Publication: 19248110;

  68. Early targets of nuclear RNP humoral autoimmunity in human systemic lupus erythematosus.

    ID: 1773725

    Description: epitope description:QGGGATPV antigen name:U1 small nuclear ribonucleoprotein A host organism:Homo sapiens

    Publication: 19248110;

  69. Early targets of nuclear RNP humoral autoimmunity in human systemic lupus erythematosus.

    ID: 1773732

    Description: epitope description:VVGAVQGP antigen name:U1 small nuclear ribonucleoprotein A host organism:Homo sapiens

    Publication: 19248110;

  70. Early targets of nuclear RNP humoral autoimmunity in human systemic lupus erythematosus.

    ID: 1773738

    Description: epitope description:GPVPGMPP antigen name:U1 small nuclear ribonucleoprotein A host organism:Homo sapiens

    Publication: 19248110;

  71. Early targets of nuclear RNP humoral autoimmunity in human systemic lupus erythematosus.

    ID: 1773758

    Description: epitope description:GQPPYMPP antigen name:U1 small nuclear ribonucleoprotein A host organism:Homo sapiens

    Publication: 19248110;

  72. Early targets of nuclear RNP humoral autoimmunity in human systemic lupus erythematosus.

    ID: 1773760

    Description: epitope description:PPYMPPPG antigen name:U1 small nuclear ribonucleoprotein A host organism:Homo sapiens

    Publication: 19248110;

  73. Early targets of nuclear RNP humoral autoimmunity in human systemic lupus erythematosus.

    ID: 1773761

    Description: epitope description:PYMPPPGM antigen name:U1 small nuclear ribonucleoprotein A host organism:Homo sapiens

    Publication: 19248110;

  74. Early targets of nuclear RNP humoral autoimmunity in human systemic lupus erythematosus.

    ID: 1773773

    Description: epitope description:GLAPGQIP antigen name:U1 small nuclear ribonucleoprotein A host organism:Homo sapiens

    Publication: 19248110;

  75. Early targets of nuclear RNP humoral autoimmunity in human systemic lupus erythematosus.

    ID: 1773778

    Description: epitope description:QIPPGAMP antigen name:U1 small nuclear ribonucleoprotein A host organism:Homo sapiens

    Publication: 19248110;

  76. Early targets of nuclear RNP humoral autoimmunity in human systemic lupus erythematosus.

    ID: 1773782

    Description: epitope description:GAMPPQQL antigen name:U1 small nuclear ribonucleoprotein A host organism:Homo sapiens

    Publication: 19248110;

  77. Early targets of nuclear RNP humoral autoimmunity in human systemic lupus erythematosus.

    ID: 1773786

    Description: epitope description:PQQLMPGQ antigen name:U1 small nuclear ribonucleoprotein A host organism:Homo sapiens

    Publication: 19248110;

  78. Early targets of nuclear RNP humoral autoimmunity in human systemic lupus erythematosus.

    ID: 1773787

    Description: epitope description:QQLMPGQM antigen name:U1 small nuclear ribonucleoprotein A host organism:Homo sapiens

    Publication: 19248110;

  79. Early targets of nuclear RNP humoral autoimmunity in human systemic lupus erythematosus.

    ID: 1773791

    Description: epitope description:PGQMPPAQ antigen name:U1 small nuclear ribonucleoprotein A host organism:Homo sapiens

    Publication: 19248110;

  80. Early targets of nuclear RNP humoral autoimmunity in human systemic lupus erythematosus.

    ID: 1773794

    Description: epitope description:MPPAQPLS antigen name:U1 small nuclear ribonucleoprotein A host organism:Homo sapiens

    Publication: 19248110;

  81. Early targets of nuclear RNP humoral autoimmunity in human systemic lupus erythematosus.

    ID: 1773796

    Description: epitope description:PAQPLSEN antigen name:U1 small nuclear ribonucleoprotein A host organism:Homo sapiens

    Publication: 19248110;

  82. Early targets of nuclear RNP humoral autoimmunity in human systemic lupus erythematosus.

    ID: 1773798

    Description: epitope description:QPLSENPP antigen name:U1 small nuclear ribonucleoprotein A host organism:Homo sapiens

    Publication: 19248110;

  83. Early targets of nuclear RNP humoral autoimmunity in human systemic lupus erythematosus.

    ID: 1773799

    Description: epitope description:PLSENPPN antigen name:U1 small nuclear ribonucleoprotein A host organism:Homo sapiens

    Publication: 19248110;

  84. Early targets of nuclear RNP humoral autoimmunity in human systemic lupus erythematosus.

    ID: 1773803

    Description: epitope description:NPPNHILF antigen name:U1 small nuclear ribonucleoprotein A host organism:Homo sapiens

    Publication: 19248110;

  85. Early targets of nuclear RNP humoral autoimmunity in human systemic lupus erythematosus.

    ID: 1773806

    Description: epitope description:NHILFLTN antigen name:U1 small nuclear ribonucleoprotein A host organism:Homo sapiens

    Publication: 19248110;

  86. Early targets of nuclear RNP humoral autoimmunity in human systemic lupus erythematosus.

    ID: 1773808

    Description: epitope description:ILFLTNLP antigen name:U1 small nuclear ribonucleoprotein A host organism:Homo sapiens

    Publication: 19248110;

  87. Early targets of nuclear RNP humoral autoimmunity in human systemic lupus erythematosus.

    ID: 1773813

    Description: epitope description:NLPEETNE antigen name:U1 small nuclear ribonucleoprotein A host organism:Homo sapiens

    Publication: 19248110;

  88. Early targets of nuclear RNP humoral autoimmunity in human systemic lupus erythematosus.

    ID: 1773823

    Description: epitope description:LSMLFNQF antigen name:U1 small nuclear ribonucleoprotein A host organism:Homo sapiens

    Publication: 19248110;

  89. Early targets of nuclear RNP humoral autoimmunity in human systemic lupus erythematosus.

    ID: 1773827

    Description: epitope description:FNQFPGFK antigen name:U1 small nuclear ribonucleoprotein A host organism:Homo sapiens

    Publication: 19248110;

  90. Early targets of nuclear RNP humoral autoimmunity in human systemic lupus erythematosus.

    ID: 1773828

    Description: epitope description:NQFPGFKE antigen name:U1 small nuclear ribonucleoprotein A host organism:Homo sapiens

    Publication: 19248110;

  91. Early targets of nuclear RNP humoral autoimmunity in human systemic lupus erythematosus.

    ID: 1773839

    Description: epitope description:VPGRHDIA antigen name:U1 small nuclear ribonucleoprotein A host organism:Homo sapiens

    Publication: 19248110;

  92. Early targets of nuclear RNP humoral autoimmunity in human systemic lupus erythematosus.

    ID: 1773846

    Description: epitope description:AFVEFDNE antigen name:U1 small nuclear ribonucleoprotein A host organism:Homo sapiens

    Publication: 19248110;

  93. Early targets of nuclear RNP humoral autoimmunity in human systemic lupus erythematosus.

    ID: 1773847

    Description: epitope description:FVEFDNEV antigen name:U1 small nuclear ribonucleoprotein A host organism:Homo sapiens

    Publication: 19248110;

  94. Early targets of nuclear RNP humoral autoimmunity in human systemic lupus erythematosus.

    ID: 1773851

    Description: epitope description:DNEVQAGA antigen name:U1 small nuclear ribonucleoprotein A host organism:Homo sapiens

    Publication: 19248110;

  95. Early targets of nuclear RNP humoral autoimmunity in human systemic lupus erythematosus.

    ID: 1773853

    Description: epitope description:EVQAGAAR antigen name:U1 small nuclear ribonucleoprotein A host organism:Homo sapiens

    Publication: 19248110;

  96. Early targets of nuclear RNP humoral autoimmunity in human systemic lupus erythematosus.

    ID: 1773856

    Description: epitope description:AGAARDAL antigen name:U1 small nuclear ribonucleoprotein A host organism:Homo sapiens

    Publication: 19248110;

  97. Early targets of nuclear RNP humoral autoimmunity in human systemic lupus erythematosus.

    ID: 1773874

    Description: epitope description:MKISFAKK antigen name:U1 small nuclear ribonucleoprotein A host organism:Homo sapiens

    Publication: 19248110;

  98. Early targets of nuclear RNP humoral autoimmunity in human systemic lupus erythematosus.

    ID: 1773877

    Description: epitope description:KFYCDYCDTY antigen name:U1 small nuclear ribonucleoprotein C host organism:Homo sapiens

    Publication: 19248110;

  99. Early targets of nuclear RNP humoral autoimmunity in human systemic lupus erythematosus.

    ID: 1773883

    Description: epitope description:HDSPSVRKTH antigen name:U1 small nuclear ribonucleoprotein C host organism:Homo sapiens

    Publication: 19248110;

  100. Early targets of nuclear RNP humoral autoimmunity in human systemic lupus erythematosus.

    ID: 1773893

    Description: epitope description:KDYYQKWMEE antigen name:U1 small nuclear ribonucleoprotein C host organism:Homo sapiens

    Publication: 19248110;
Displaying 100 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston