Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 20 of 1,510,353 results for " "

  1. Antigenic structure analysis of glycosylated protein 3 of porcine reproductive and respiratory syndrome virus.

    ID: 1489085

    Description: epitope description:DELGFMVPPGLSSE antigen name:Glycoprotein 3 host organism:Sus scrofa

    Publication: 16384621;

  2. Antigenic structure analysis of glycosylated protein 3 of porcine reproductive and respiratory syndrome virus.

    ID: 1489091

    Description: epitope description:YEPGRSLW antigen name:Glycoprotein 3 host organism:Mus musculus BALB/c antibody name:31A2, 32D4, 32H7

    Publication: 16384621;

  3. Mapping of B-cell epitopes of hemagglutinin protein of rinderpest virus.

    ID: 1489157

    Description: epitope description:ECFPWDRKL antigen name:Hemagglutinin glycoprotein host organism:Mus musculus BALB/c antibody name:E2G4

    Publication: 12127784;

  4. Major linear IgE epitopes of mountain cedar pollen allergen Jun a 1 map to the pectate lyase catalytic site.

    ID: 1489182

    Description: epitope description:QNRMKLADCAVGF antigen name:Jun a 1 host organism:Homo sapiens

    Publication: 14563374;

  5. Major linear IgE epitopes of mountain cedar pollen allergen Jun a 1 map to the pectate lyase catalytic site.

    ID: 1489186

    Description: epitope description:KGGDFYTVTSTDD antigen name:Jun a 1 host organism:Homo sapiens

    Publication: 14563374;

  6. Peptide-specific antibodies as probes of the topography of the voltage-gated channel in the mitochondrial outer membrane of Neurospora crassa.

    ID: 1496446

    Description: epitope description:MAVPAFSDIAKSANDLLNKD antigen name:Mitochondrial outer membrane protein porin host organism:Oryctolagus cuniculus

    Publication: 7542652;

  7. Determination of neutralizing epitopes in variable domains I and IV of the major outer-membrane protein from Chlamydia trachomatis serovar K.

    ID: 1496488

    Description: epitope description:LDVTTLNPTI host organism:Mus musculus BALB/c antibody name:5C2, DP10

    Publication: 7524957;

  8. Influence of epitope polarity and adjuvants on the immunogenicity and efficacy of a synthetic peptide vaccine against Semliki Forest virus.

    ID: 1496508

    Description: epitope description:GREKFTIRPHYGKEIPFVPRADEPARKGKVH host organism:Mus musculus BALB/c

    Publication: 7690411;

  9. Influence of epitope polarity and adjuvants on the immunogenicity and efficacy of a synthetic peptide vaccine against Semliki Forest virus.

    ID: 1496518

    Description: epitope description:PFVPRADEPARKGKVHGREKFTIRPHYGKEI host organism:Mus musculus BALB/c

    Publication: 7690411;

  10. A novel multi-antigen virally vectored vaccine against Mycobacterium avium subspecies paratuberculosis.

    ID: 1496608

    Description: epitope description:FFWPKDFTFVCPTEI antigen name:AhpC host organism:Mus musculus C57BL/6

    Publication: 18043737;

  11. The effect of orientation within a chimeric peptide on the immunogenicity of Chlamydia trachomatis epitopes.

    ID: 1496610

    Description: epitope description:SATAIFDTTTLNPTIAG antigen name:Major outer membrane porin, serovar D host organism:Mus musculus C57BL/10

    Publication: 8676884;

  12. A novel multi-antigen virally vectored vaccine against Mycobacterium avium subspecies paratuberculosis.

    ID: 1496621

    Description: epitope description:QVLGVSIDSEFVHFN antigen name:AhpC host organism:Mus musculus C57BL/6

    Publication: 18043737;

  13. The effect of orientation within a chimeric peptide on the immunogenicity of Chlamydia trachomatis epitopes.

    ID: 1496631

    Description: epitope description:VAGLQNDPT host organism:Mus musculus C57BL/10

    Publication: 8676884;

  14. A novel multi-antigen virally vectored vaccine against Mycobacterium avium subspecies paratuberculosis.

    ID: 1496635

    Description: epitope description:LPFPMLSDIKRELSL antigen name:AhpC host organism:Mus musculus C57BL/6

    Publication: 18043737;

  15. A novel multi-antigen virally vectored vaccine against Mycobacterium avium subspecies paratuberculosis.

    ID: 1496643

    Description: epitope description:ADRATFIVDPNNEIQ antigen name:AhpC host organism:Mus musculus C57BL/6

    Publication: 18043737;

  16. Peptide-specific antibodies as probes of the topography of the voltage-gated channel in the mitochondrial outer membrane of Neurospora crassa.

    ID: 1496671

    Description: epitope description:MAVPAFSDIAKSANDLLNKD antigen name:Mitochondrial outer membrane protein porin host organism:Oryctolagus cuniculus

    Publication: 7542652;

  17. Identification of surface-exposed B-cell epitopes recognized by Haemophilus influenzae type b P1-specific monoclonal antibodies.

    ID: 1496715

    Description: epitope description:VKTIGDKRTLTLNTTANYT antigen name:Outer membrane protein P1 host organism:Mus musculus BALB/c antibody name:3E12

    Publication: 7682997;

  18. Naturally occurring MHR variants in Turkish patients infected with hepatitis B virus.

    ID: 1496732

    Description: epitope description:S143 antigen name:Large envelope protein host organism:Mus musculus antibody name:Vitros ECi/HBsAg

    Publication: 18205223;

  19. Characterization of cross-reactive and serotype-specific epitopes on the nucleocapsid proteins of hantaviruses.

    ID: 1496733

    Description: epitope description:QLVTARQKLKDAEKAVEVDPDDVNKSTLQNRRAAVSTLETKLG antigen name:Andes orthohantavirus protein host organism:Mus musculus antibody name:7E...

    Publication: 18342973;

  20. Antigenic sites on porin of Haemophilus influenzae type b: mapping with synthetic peptides and evaluation of structure predictions.

    ID: 1496783

    Description: epitope description:DKEYGVLNNSD antigen name:Outer membrane protein P2 host organism:Mus musculus BALB/c antibody name:POR.1

    Publication: 1375930;
Displaying 20 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston