Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Antibody responses to hepatitis C virus hypervariable region 1: evidence for cross-reactivity and immune-mediated sequence variation.

    ID: 1332556

    Description: epitope description:KAGSTVYAVTAVTSIFSVG antigen name:Genome polyprotein host organism:Homo sapiens antibody name:anti-HVR1

    Publication: 10421665;

  2. Antibody responses to hepatitis C virus hypervariable region 1: evidence for cross-reactivity and immune-mediated sequence variation.

    ID: 1332558

    Description: epitope description:KAGSTVYAVTAVTSIFSVG antigen name:Genome polyprotein host organism:Homo sapiens antibody name:anti-HVR1

    Publication: 10421665;

  3. Temporal variations in immune responses to conserved regions of Plasmodium falciparum merozoite surface proteins related to the severity of a prior ma...

    ID: 1332561

    Description: epitope description:SNTFINNA antigen name:Other Plasmodium falciparum (malaria parasite P. falciparum) protein host organism:Homo sapiens

    Publication: 15259482;

  4. Temporal variations in immune responses to conserved regions of Plasmodium falciparum merozoite surface proteins related to the severity of a prior ma...

    ID: 1332563

    Description: epitope description:NTSDSQKE antigen name:Other Plasmodium falciparum (malaria parasite P. falciparum) protein host organism:Homo sapiens

    Publication: 15259482;

  5. Antibody responses to hepatitis C virus hypervariable region 1: evidence for cross-reactivity and immune-mediated sequence variation.

    ID: 1332572

    Description: epitope description:QAGRTAHAVTNIFSVG antigen name:Genome polyprotein host organism:Homo sapiens antibody name:anti-HVR1

    Publication: 10421665;

  6. Human antibodies to the polymorphic block 2 domain of the Plasmodium falciparum merozoite surface protein 1 (MSP-1) exhibit a highly skewed, peptide-s...

    ID: 1332574

    Description: epitope description:KNQLAGKDEYEAKQKEAE antigen name:Heat shock 70 kDa protein host organism:Homo sapiens

    Publication: 16033534;

  7. Antibody responses to hepatitis C virus hypervariable region 1: evidence for cross-reactivity and immune-mediated sequence variation.

    ID: 1332578

    Description: epitope description:SAGRSTGSLVRLFAPG antigen name:Genome polyprotein host organism:Homo sapiens antibody name:anti-HVR1

    Publication: 10421665;

  8. The most polymorphic residue on Plasmodium falciparum apical membrane antigen 1 determines binding of an invasion-inhibitory antibody.

    ID: 1332580

    Description: epitope description:E189 antigen name:Apical membrane antigen 1 host organism:Mus musculus antibody name:1F9

    Publication: 16622199;

  9. Antibody responses to hepatitis C virus hypervariable region 1: evidence for cross-reactivity and immune-mediated sequence variation.

    ID: 1332583

    Description: epitope description:SVGHMTGRFTSLFSVG antigen name:Genome polyprotein host organism:Homo sapiens antibody name:anti-HVR1

    Publication: 10421665;

  10. Antibody responses to hepatitis C virus hypervariable region 1: evidence for cross-reactivity and immune-mediated sequence variation.

    ID: 1332590

    Description: epitope description:SVGHMTGRFTSLFSVG antigen name:Genome polyprotein host organism:Homo sapiens antibody name:anti-HVR1

    Publication: 10421665;

  11. Antibody responses to hepatitis C virus hypervariable region 1: evidence for cross-reactivity and immune-mediated sequence variation.

    ID: 1332600

    Description: epitope description:SAAYATSSFSSLFTRG antigen name:Genome polyprotein host organism:Homo sapiens antibody name:anti-HVR1

    Publication: 10421665;

  12. Antibody responses to hepatitis C virus hypervariable region 1: evidence for cross-reactivity and immune-mediated sequence variation.

    ID: 1332629

    Description: epitope description:AVGYRASRTVSLFSPG antigen name:Genome polyprotein host organism:Homo sapiens antibody name:anti-HVR1

    Publication: 10421665;

  13. The IgE-binding epitopes of rPar j 2, a major allergen of Parietaria judaica pollen, are heterogeneously recognized among allergic subjects.

    ID: 1332633

    Description: epitope description:EACGKVVQDIMPCLHFVKGEEKEPSKECCS antigen name:Par j 2 host organism:Homo sapiens

    Publication: 10753015;

  14. High non-protective, long-lasting antibody levels in malaria are associated with haplotype shifting in MHC-peptide-TCR complex formation: a new mechan...

    ID: 1332659

    Description: epitope description:TDVNRYRYSNNYEAIPHIS antigen name:DNAJ protein, putative host organism:Aotus nancymaae antibody name:Monkey sera

    Publication: 16483708;

  15. High non-protective, long-lasting antibody levels in malaria are associated with haplotype shifting in MHC-peptide-TCR complex formation: a new mechan...

    ID: 1332662

    Description: epitope description:WGEEKRASHTTPVLMEKPYY antigen name:Apical membrane antigen 1 host organism:Aotus nancymaae antibody name:Monkey sera

    Publication: 16483708;

  16. Multiple sequence-reactive antibodies induced by a single peptide immunization with hypervariable region 1 of hepatitis C virus.

    ID: 1324797

    Description: epitope description:QTRVTGGTAGHITSGLTSLFVRGPSQKIQLI antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10191201;

  17. Multiple sequence-reactive antibodies induced by a single peptide immunization with hypervariable region 1 of hepatitis C virus.

    ID: 1324800

    Description: epitope description:QTRVTGGTAGHITSGLTSLFVRGPSQKIQLI antigen name:Genome polyprotein host organism:Pan troglodytes

    Publication: 10191201;

  18. Multiple sequence-reactive antibodies induced by a single peptide immunization with hypervariable region 1 of hepatitis C virus.

    ID: 1324812

    Description: epitope description:QTHVTGGTQGYTTQGFVGLFTRGPSQKIQLV antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10191201;

  19. Multiple sequence-reactive antibodies induced by a single peptide immunization with hypervariable region 1 of hepatitis C virus.

    ID: 1324814

    Description: epitope description:QTHVTGGTQGYTTQGFVGLFTRGPSQKIQLV antigen name:Genome polyprotein host organism:Mus musculus BDF1

    Publication: 10191201;

  20. Multiple sequence-reactive antibodies induced by a single peptide immunization with hypervariable region 1 of hepatitis C virus.

    ID: 1324822

    Description: epitope description:ATYTTGGTAGHYTSKFASLFSSGSSQKIQLI antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10191201;

  21. Multiple sequence-reactive antibodies induced by a single peptide immunization with hypervariable region 1 of hepatitis C virus.

    ID: 1324824

    Description: epitope description:ATYTTGGTAGHYTSKFASLFSSGSSQKIQLI antigen name:Genome polyprotein host organism:Mus musculus BDF1

    Publication: 10191201;

  22. Multiple sequence-reactive antibodies induced by a single peptide immunization with hypervariable region 1 of hepatitis C virus.

    ID: 1324833

    Description: epitope description:HTHVSGGAQAFTTRGFVGLFTTGPSQKIQLV antigen name:Genome polyprotein host organism:Pan troglodytes

    Publication: 10191201;

  23. Multiple sequence-reactive antibodies induced by a single peptide immunization with hypervariable region 1 of hepatitis C virus.

    ID: 1324894

    Description: epitope description:TLRGVTSFFSPGASQKIQLI antigen name:Genome polyprotein host organism:Pan troglodytes

    Publication: 10191201;

  24. Multiple sequence-reactive antibodies induced by a single peptide immunization with hypervariable region 1 of hepatitis C virus.

    ID: 1324942

    Description: epitope description:VTSTLTSLFRPGASQKIQLV antigen name:Genome polyprotein host organism:Pan troglodytes

    Publication: 10191201;

  25. Functional analysis of Bacillus anthracis protective antigen by using neutralizing monoclonal antibodies.

    ID: 1325074

    Description: epitope description:SKNLAPI antigen name:Protective antigen host organism:Mus musculus BP2 antibody name:mAb 48.3

    Publication: 15501759;

  26. Detection of prion protein using a capillary electrophoresis-based competitive immunoassay with laser-induced fluorescence detection and cyclodextrin-...

    ID: 1325521

    Description: epitope description:GSDYEDRYYRENMHRYPNQ antigen name:Major prion protein host organism:Mus musculus PrP null antibody name:12F10

    Publication: 15815999;

  27. Murine humoral immune response against recombinant structural proteins of hepatitis C virus distinct from those of patients.

    ID: 1325659

    Description: epitope description:VGGVYLLPRRGPRLGVRAIR antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 8867614;

  28. Murine humoral immune response against recombinant structural proteins of hepatitis C virus distinct from those of patients.

    ID: 1325666

    Description: epitope description:DVKFPGGGQIVGGVYLLPRR antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 8867614;

  29. Murine humoral immune response against recombinant structural proteins of hepatitis C virus distinct from those of patients.

    ID: 1325677

    Description: epitope description:HTLTTGGHAARLTSGFAGLF antigen name:Genome polyprotein host organism:Mus musculus C57BL/6

    Publication: 8867614;

  30. Murine humoral immune response against recombinant structural proteins of hepatitis C virus distinct from those of patients.

    ID: 1325680

    Description: epitope description:KFDQGWGPITYAEPTKDPDQ antigen name:Genome polyprotein host organism:Mus musculus C57BL/6

    Publication: 8867614;

  31. Murine humoral immune response against recombinant structural proteins of hepatitis C virus distinct from those of patients.

    ID: 1325703

    Description: epitope description:RTALNCNDSLQTGFLAALFY antigen name:Genome polyprotein host organism:Mus musculus C57BL/6

    Publication: 8867614;

  32. Murine humoral immune response against recombinant structural proteins of hepatitis C virus distinct from those of patients.

    ID: 1325712

    Description: epitope description:LTPRCMVDYPYRLWHYPCTV antigen name:Genome polyprotein host organism:Mus musculus C57BL/6

    Publication: 8867614;

  33. Murine humoral immune response against recombinant structural proteins of hepatitis C virus distinct from those of patients.

    ID: 1325717

    Description: epitope description:DVKFPGGGQIVGGVYLLPRR antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 8867614;

  34. Murine humoral immune response against recombinant structural proteins of hepatitis C virus distinct from those of patients.

    ID: 1325718

    Description: epitope description:VGGVYLLPRRGPRLGVRAIR antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 8867614;

  35. Murine humoral immune response against recombinant structural proteins of hepatitis C virus distinct from those of patients.

    ID: 1325719

    Description: epitope description:GPRLGVRAIRKTSERSQPRG antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 8867614;

  36. Murine humoral immune response against recombinant structural proteins of hepatitis C virus distinct from those of patients.

    ID: 1325721

    Description: epitope description:RRQPIPKARRPEGRAWAQPG antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 8867614;

  37. Murine humoral immune response against recombinant structural proteins of hepatitis C virus distinct from those of patients.

    ID: 1325728

    Description: epitope description:HVTNDCSNSSIVFEAADLIM antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 8867614;

  38. Murine humoral immune response against recombinant structural proteins of hepatitis C virus distinct from those of patients.

    ID: 1325731

    Description: epitope description:EGNSSRCWVALTPTLAARNA antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 8867614;

  39. Murine humoral immune response against recombinant structural proteins of hepatitis C virus distinct from those of patients.

    ID: 1325732

    Description: epitope description:LTPTLAARNATIPTTTIRHH antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 8867614;

  40. Murine humoral immune response against recombinant structural proteins of hepatitis C virus distinct from those of patients.

    ID: 1325733

    Description: epitope description:TIPTTTIRHHVDLLVGAAAL antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 8867614;

  41. Murine humoral immune response against recombinant structural proteins of hepatitis C virus distinct from those of patients.

    ID: 1325741

    Description: epitope description:RLTSGFAGLFTPGPSQRIQL antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 8867614;

  42. Murine humoral immune response against recombinant structural proteins of hepatitis C virus distinct from those of patients.

    ID: 1325748

    Description: epitope description:KFDQGWGPITYAEPTKDPDQ antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 8867614;

  43. Murine humoral immune response against recombinant structural proteins of hepatitis C virus distinct from those of patients.

    ID: 1325760

    Description: epitope description:TDCFRKHPEATYSKCGSGPW antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 8867614;

  44. Murine humoral immune response against recombinant structural proteins of hepatitis C virus distinct from those of patients.

    ID: 1325761

    Description: epitope description:TYSKCGSGPWLTPRCMVDYP antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 8867614;

  45. Identification of hepatitis C virus (HCV) 2a-derived epitope peptides having the capacity to induce cytotoxic T lymphocytes in human leukocyte antigen...

    ID: 1325890

    Description: epitope description:DFNASTDLL antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 16963008;

  46. Identification of hepatitis C virus (HCV) 2a-derived epitope peptides having the capacity to induce cytotoxic T lymphocytes in human leukocyte antigen...

    ID: 1325894

    Description: epitope description:VYHGAGNKTL antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 16963008;

  47. Identification of hepatitis C virus (HCV) 2a-derived epitope peptides having the capacity to induce cytotoxic T lymphocytes in human leukocyte antigen...

    ID: 1325897

    Description: epitope description:EFWEAVFTGL antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 16963008;

  48. Plasmid DNA and protein vaccination of mice to the outer surface protein A of Borrelia burgdorferi leads to induction of T helper cells with specifici...

    ID: 1325901

    Description: epitope description:ACKQNVSSLDEKNSVSVD antigen name:Outer surface protein A host organism:Mus musculus AKR

    Publication: 8921965;

  49. Immunological mimicry between retinal S-antigen and group A streptococcal M proteins.

    ID: 1325904

    Description: epitope description:TIGTLKKILDETVKDKIA antigen name:UniProt:A2RGM0 host organism:Mus musculus antibody name:B11A11

    Publication: 8722579;

  50. Immunological mimicry between retinal S-antigen and group A streptococcal M proteins.

    ID: 1325908

    Description: epitope description:DKLAKEQKSKQNIGALKQ antigen name:UniProt:A2RGM0 host organism:Mus musculus antibody name:B11A11, D9F2

    Publication: 8722579;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston