Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 100 of 1,510,353 results for " "

  1. Elevated antibodies to synthetic peptides of HTLV-1 envelope transmembrane glycoproteins in patients with HAM/TSP.

    ID: 1384331

    Description: epitope description:QHDVNFTQEVSRLNINLHFSKCGFPF antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 1955565;

  2. Elevated antibodies to synthetic peptides of HTLV-1 envelope transmembrane glycoproteins in patients with HAM/TSP.

    ID: 1384333

    Description: epitope description:FLNTEPSQLPPTAPPLLPHSNLDHI antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 1955565;

  3. Elevated antibodies to synthetic peptides of HTLV-1 envelope transmembrane glycoproteins in patients with HAM/TSP.

    ID: 1384337

    Description: epitope description:LVQLTLQSTNYTCIVCIDRASLST antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 1955565;

  4. Elevated antibodies to synthetic peptides of HTLV-1 envelope transmembrane glycoproteins in patients with HAM/TSP.

    ID: 1384338

    Description: epitope description:STWHVLYSPNVSVPSSSSTP antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 1955565;

  5. Elevated antibodies to synthetic peptides of HTLV-1 envelope transmembrane glycoproteins in patients with HAM/TSP.

    ID: 1384352

    Description: epitope description:CRFPNITNSHVPILQERPPLENRVLTGYGL host organism:Homo sapiens

    Publication: 1955565;

  6. Elevated antibodies to synthetic peptides of HTLV-1 envelope transmembrane glycoproteins in patients with HAM/TSP.

    ID: 1384360

    Description: epitope description:FLNTEPSQLPPTAPPLLPHSNLDHI antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 1955565;

  7. Delineation of contiguous determinants essential for biological functions of the pre-S sequence of the hepatitis B virus envelope protein: its antigen...

    ID: 1384383

    Description: epitope description:STTFHQTLQDPRVRGLYFPAGGSSSGTVNP antigen name:Large envelope protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2462893;

  8. Delineation of contiguous determinants essential for biological functions of the pre-S sequence of the hepatitis B virus envelope protein: its antigen...

    ID: 1384391

    Description: epitope description:MQWNSTAFHQTLQDPRVRGLYLPAGGSSSGTVNP antigen name:Large envelope protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2462893;

  9. Delineation of contiguous determinants essential for biological functions of the pre-S sequence of the hepatitis B virus envelope protein: its antigen...

    ID: 1384394

    Description: epitope description:MQWNSTAFHQTLQDPRVRGLYLPAGG antigen name:Large envelope protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2462893;

  10. Monoclonal antibody against non-dominant epitopes of HBV e Ag was raised by antigen-antibody co-immunization.

    ID: 1384396

    Description: epitope description:LVSFGVWIRTPPAYRPPN antigen name:External core antigen host organism:Mus musculus antibody name:EWB

    Publication: 17408795;

  11. Delineation of contiguous determinants essential for biological functions of the pre-S sequence of the hepatitis B virus envelope protein: its antigen...

    ID: 1384403

    Description: epitope description:MGTNLSVPNPLGFFPDHQLDP antigen name:Large envelope protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2462893;

  12. Delineation of contiguous determinants essential for biological functions of the pre-S sequence of the hepatitis B virus envelope protein: its antigen...

    ID: 1384405

    Description: epitope description:PLGFFPDHQLDPAFGANSNNPDWDFNP antigen name:Large envelope protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2462893;

  13. Antigenic and functional analysis of a neutralization site of HSV-1 glycoprotein D.

    ID: 1384752

    Description: epitope description:S165 antigen name:Envelope glycoprotein D host organism:Mus musculus antibody name:DL11

    Publication: 2154881;

  14. Antigenic and functional analysis of a neutralization site of HSV-1 glycoprotein D.

    ID: 1384790

    Description: epitope description:S241 antigen name:Envelope glycoprotein D host organism:Mus musculus BALB/c antibody name:LP2

    Publication: 2154881;

  15. Human immune responses to the Plasmodium falciparum ring-infected erythrocyte surface antigen (Pf155/RESA) after a decrease in malaria transmission in...

    ID: 1384802

    Description: epitope description:EENVEHDAEENVEHDAEENVEHDAEENVEHDA antigen name:DNAJ protein, putative host organism:Homo sapiens

    Publication: 8470778;

  16. Linear epitopes of the replication-activator protein of Epstein-Barr virus recognised by specific serum IgG in nasopharyngeal carcinoma.

    ID: 1384831

    Description: epitope description:QAPLPCVLWPVLPEPLPQGQLT antigen name:Trans-activator protein BZLF1 host organism:Homo sapiens

    Publication: 7750123;

  17. Linear epitopes of the replication-activator protein of Epstein-Barr virus recognised by specific serum IgG in nasopharyngeal carcinoma.

    ID: 1384833

    Description: epitope description:PQGQLTAYHVSTAPTGSWFSAP antigen name:Trans-activator protein BZLF1 host organism:Homo sapiens

    Publication: 7750123;

  18. Linear epitopes of the replication-activator protein of Epstein-Barr virus recognised by specific serum IgG in nasopharyngeal carcinoma.

    ID: 1384847

    Description: epitope description:EECDSELEIKRYKNRVASRKCR antigen name:Trans-activator protein BZLF1 host organism:Homo sapiens

    Publication: 7750123;

  19. Linear epitopes of the replication-activator protein of Epstein-Barr virus recognised by specific serum IgG in nasopharyngeal carcinoma.

    ID: 1384854

    Description: epitope description:LDVDSIIPRTPDVLHEDLLNF antigen name:Trans-activator protein BZLF1 host organism:Homo sapiens

    Publication: 7750123;

  20. Immunization with a synthetic multiepitope antigen induces humoral and cellular immune responses to hepatitis C virus in mice.

    ID: 1384860

    Description: epitope description:TGDFDSVID antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:anti-PCX3

    Publication: 17425431;

  21. A new epitope peptide derived from hepatitis C virus 1b possessing the capacity to induce cytotoxic T-lymphocytes in HCV1b-infected patients with HLA-...

    ID: 1384864

    Description: epitope description:IVGGVYLLPR antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 17265020;

  22. A new epitope peptide derived from hepatitis C virus 1b possessing the capacity to induce cytotoxic T-lymphocytes in HCV1b-infected patients with HLA-...

    ID: 1384876

    Description: epitope description:DVLLLNNTR antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 17265020;

  23. A new epitope peptide derived from hepatitis C virus 1b possessing the capacity to induce cytotoxic T-lymphocytes in HCV1b-infected patients with HLA-...

    ID: 1384877

    Description: epitope description:WMNSTGFTK antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 17265020;

  24. A new epitope peptide derived from hepatitis C virus 1b possessing the capacity to induce cytotoxic T-lymphocytes in HCV1b-infected patients with HLA-...

    ID: 1384892

    Description: epitope description:GVVCAAILR antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 17265020;

  25. A new epitope peptide derived from hepatitis C virus 1b possessing the capacity to induce cytotoxic T-lymphocytes in HCV1b-infected patients with HLA-...

    ID: 1384894

    Description: epitope description:LTITQLLKR antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 17265020;

  26. A new epitope peptide derived from hepatitis C virus 1b possessing the capacity to induce cytotoxic T-lymphocytes in HCV1b-infected patients with HLA-...

    ID: 1384896

    Description: epitope description:WLQSKLLPR antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 17265020;

  27. A new epitope peptide derived from hepatitis C virus 1b possessing the capacity to induce cytotoxic T-lymphocytes in HCV1b-infected patients with HLA-...

    ID: 1384902

    Description: epitope description:KLTPPHSAK antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 17265020;

  28. A new epitope peptide derived from hepatitis C virus 1b possessing the capacity to induce cytotoxic T-lymphocytes in HCV1b-infected patients with HLA-...

    ID: 1384905

    Description: epitope description:VMGSSYGFQY antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 17265020;

  29. A new epitope peptide derived from hepatitis C virus 1b possessing the capacity to induce cytotoxic T-lymphocytes in HCV1b-infected patients with HLA-...

    ID: 1384912

    Description: epitope description:GVGIYLLPNR antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 17265020;

  30. Identification of an immunodominant sequential epitope in glycoprotein G of herpes simplex virus type 2 that is useful for serotype-specific diagnosis...

    ID: 1385115

    Description: epitope description:PEEFEGAGDGEPPEDDDS antigen name:Envelope glycoprotein G host organism:Homo sapiens

    Publication: 9700637;

  31. Molecular fine-specificity analysis of antibody responses to human cytomegalovirus and design of novel synthetic-peptide-based serodiagnostic assays.

    ID: 1385392

    Description: epitope description:TPTPVNPSTAPAPAPTPTFACCQTPVNGNSPWAPTAPLPGDM antigen name:Other Human betaherpesvirus 5 (Human cytomegalovirus) protein host organis...

    Publication: 9854087;

  32. Molecular fine-specificity analysis of antibody responses to human cytomegalovirus and design of novel synthetic-peptide-based serodiagnostic assays.

    ID: 1385397

    Description: epitope description:FLTEEPFQRGDPFDKNYVGNSGKSRGGG antigen name:DNA polymerase processivity factor host organism:Homo sapiens

    Publication: 9854087;

  33. Molecular fine-specificity analysis of antibody responses to human cytomegalovirus and design of novel synthetic-peptide-based serodiagnostic assays.

    ID: 1385400

    Description: epitope description:GGSLSSLANAGGLHDDG antigen name:DNA polymerase processivity factor host organism:Homo sapiens

    Publication: 9854087;

  34. Antibodies against heat shock protein 60 derived from Helicobacter pylori: diagnostic implications in cardiovascular disease.

    ID: 1386143

    Description: epitope description:QVATISAN antigen name:60 kDa chaperonin host organism:Homo sapiens

    Publication: 17606364;

  35. Antibodies against heat shock protein 60 derived from Helicobacter pylori: diagnostic implications in cardiovascular disease.

    ID: 1386145

    Description: epitope description:DELDVVEGMQFDRGYLS antigen name:60 kDa chaperonin host organism:Homo sapiens

    Publication: 17606364;

  36. A novel approach for investigation of specific and cross-reactive IgE epitopes on Bet v 1 and homologous food allergens in individual patients.

    ID: 1386817

    Description: epitope description:EPDKMTT host organism:Homo sapiens antibody name:patient #1 serum IgE

    Publication: 16199263;

  37. A novel approach for investigation of specific and cross-reactive IgE epitopes on Bet v 1 and homologous food allergens in individual patients.

    ID: 1387369

    Description: epitope description:AVTFSKG host organism:Homo sapiens antibody name:patient #1 serum IgE

    Publication: 16199263;

  38. A novel approach for investigation of specific and cross-reactive IgE epitopes on Bet v 1 and homologous food allergens in individual patients.

    ID: 1387895

    Description: epitope description:IKLPALF host organism:Homo sapiens antibody name:patient #2 serum IgE

    Publication: 16199263;

  39. A novel approach for investigation of specific and cross-reactive IgE epitopes on Bet v 1 and homologous food allergens in individual patients.

    ID: 1387896

    Description: epitope description:IKLPALF host organism:Homo sapiens antibody name:patient #2 serum IgE

    Publication: 16199263;

  40. Epstein-Barr virus nuclear antigen 1 linear epitopes that are reactive with immunoglobulin A (IgA) or IgG in sera from nasopharyngeal carcinoma patien...

    ID: 1376855

    Description: epitope description:AGAGGGAGGAGAGGGAGGAG antigen name:Epstein-Barr nuclear antigen 1 host organism:Homo sapiens

    Publication: 1719023;

  41. Epstein-Barr virus nuclear antigen 1 linear epitopes that are reactive with immunoglobulin A (IgA) or IgG in sera from nasopharyngeal carcinoma patien...

    ID: 1376859

    Description: epitope description:GAGGGAGAGGAGAGGGGRGR antigen name:Epstein-Barr nuclear antigen 1 host organism:Homo sapiens

    Publication: 1719023;

  42. Epstein-Barr virus nuclear antigen 1 linear epitopes that are reactive with immunoglobulin A (IgA) or IgG in sera from nasopharyngeal carcinoma patien...

    ID: 1376868

    Description: epitope description:RGGSRERARGRGRGRGEKRP antigen name:Epstein-Barr nuclear antigen 1 host organism:Homo sapiens

    Publication: 1719023;

  43. Epstein-Barr virus nuclear antigen 1 linear epitopes that are reactive with immunoglobulin A (IgA) or IgG in sera from nasopharyngeal carcinoma patien...

    ID: 1376870

    Description: epitope description:RGRGRGEKRPRSPSSQSSSS antigen name:Epstein-Barr nuclear antigen 1 host organism:Homo sapiens

    Publication: 1719023;

  44. Epstein-Barr virus nuclear antigen 1 linear epitopes that are reactive with immunoglobulin A (IgA) or IgG in sera from nasopharyngeal carcinoma patien...

    ID: 1376878

    Description: epitope description:RRPFFHPVGEADYFEYHQEG antigen name:Epstein-Barr nuclear antigen 1 host organism:Homo sapiens

    Publication: 1719023;

  45. Epstein-Barr virus nuclear antigen 1 linear epitopes that are reactive with immunoglobulin A (IgA) or IgG in sera from nasopharyngeal carcinoma patien...

    ID: 1376882

    Description: epitope description:PGEGPSTGPRGQGDGGRRKK antigen name:Epstein-Barr nuclear antigen 1 host organism:Homo sapiens

    Publication: 1719023;

  46. Epstein-Barr virus nuclear antigen 1 linear epitopes that are reactive with immunoglobulin A (IgA) or IgG in sera from nasopharyngeal carcinoma patien...

    ID: 1376886

    Description: epitope description:TWVAGVFVYGGSKTSLYNLR antigen name:Epstein-Barr nuclear antigen 1 host organism:Homo sapiens

    Publication: 1719023;

  47. Epstein-Barr virus nuclear antigen 1 linear epitopes that are reactive with immunoglobulin A (IgA) or IgG in sera from nasopharyngeal carcinoma patien...

    ID: 1376887

    Description: epitope description:TWVAGVFVYGGSKTSLYNLR antigen name:Epstein-Barr nuclear antigen 1 host organism:Homo sapiens

    Publication: 1719023;

  48. Epstein-Barr virus nuclear antigen 1 linear epitopes that are reactive with immunoglobulin A (IgA) or IgG in sera from nasopharyngeal carcinoma patien...

    ID: 1376889

    Description: epitope description:AEVLKDAIKDLVMTKPAPTC antigen name:Epstein-Barr nuclear antigen 1 host organism:Homo sapiens

    Publication: 1719023;

  49. Use of synthetic peptides to map the antigenic determinants of glycoprotein D of herpes simplex virus.

    ID: 1376918

    Description: epitope description:NKSLGACPIR antigen name:Envelope glycoprotein D host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2457115;

  50. Use of synthetic peptides to map the antigenic determinants of glycoprotein D of herpes simplex virus.

    ID: 1376926

    Description: epitope description:LEHRAKGSCK antigen name:Envelope glycoprotein D host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2457115;

  51. Use of synthetic peptides to map the antigenic determinants of glycoprotein D of herpes simplex virus.

    ID: 1376957

    Description: epitope description:ELAPEDPEDS antigen name:Envelope glycoprotein D host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2457115;

  52. The immune response to Epstein-Barr nuclear antigen: conformational and structural features of antibody binding to synthetic peptides.

    ID: 1376962

    Description: epitope description:GGGAGGAGAGGGAGGAG antigen name:Epstein-Barr nuclear antigen 1 host organism:Oryctolagus cuniculus

    Publication: 6096700;

  53. Use of synthetic peptides to map the antigenic determinants of glycoprotein D of herpes simplex virus.

    ID: 1376985

    Description: epitope description:GASEDVRKQP antigen name:Envelope glycoprotein D host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2457115;

  54. Immune response to an epitope of the NS4 protein of hepatitis C virus in HCV-related disorders.

    ID: 1376995

    Description: epitope description:AFASRGNHVSPTHYVPESDA antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 9614926;

  55. Immune response to an epitope of the NS4 protein of hepatitis C virus in HCV-related disorders.

    ID: 1376997

    Description: epitope description:AFASRGNHVAPTHYVTESDA antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 9614926;

  56. Fine mapping of bovine herpesvirus 1 (BHV-1) glycoprotein C neutralizing epitopes by type-specific monoclonal antibodies and synthetic peptides.

    ID: 1377011

    Description: epitope description:AGNASRDGRPS antigen name:envelope glycoprotein C host organism:Mus musculus BALB/c antibody name:MAb 24

    Publication: 9453139;

  57. Hemagglutinin-neuraminidase (HN) amino acid alterations in neutralization escape mutants of Kilham mumps virus.

    ID: 1377082

    Description: epitope description:G352, P353, D358, R360 antigen name:Mumps rubulavirus protein host organism:Mus musculus antibody name:5500

    Publication: 1705373;

  58. Immunological cross-reactivity between mimicking epitopes on a virus protein and a human autoantigen depends on a single amino acid residue.

    ID: 1377110

    Description: epitope description:REDDQPSS antigen name:Envelope glycoprotein D host organism:Oryctolagus cuniculus

    Publication: 1688524;

  59. Analysis of the role of antibody-dependent cellular cytotoxic antibody activity in murine neonatal herpes simplex virus infection with antibodies to s...

    ID: 1377133

    Description: epitope description:YALADASLKMADPNRFRGKD antigen name:Envelope glycoprotein D host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2164044;

  60. Analysis of the role of antibody-dependent cellular cytotoxic antibody activity in murine neonatal herpes simplex virus infection with antibodies to s...

    ID: 1377139

    Description: epitope description:ADPNRFRGKD antigen name:Envelope glycoprotein D host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2164044;

  61. Analysis of the role of antibody-dependent cellular cytotoxic antibody activity in murine neonatal herpes simplex virus infection with antibodies to s...

    ID: 1377142

    Description: epitope description:QAYQQGVTVD antigen name:Envelope glycoprotein D host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2164044;

  62. Localization and synthesis of an antigenic determinant of herpes simplex virus glycoprotein D that stimulates the production of neutralizing antibody.

    ID: 1377281

    Description: epitope description:SLKMADPNRFRGKDLP antigen name:Envelope glycoprotein D host organism:Oryctolagus cuniculus antibody name:anti-gD-1

    Publication: 6197535;

  63. Localization and synthesis of an antigenic determinant of herpes simplex virus glycoprotein D that stimulates the production of neutralizing antibody.

    ID: 1377283

    Description: epitope description:SLKMADPNRFRGKDLP antigen name:Envelope glycoprotein D host organism:Oryctolagus cuniculus antibody name:anti-gD-2

    Publication: 6197535;

  64. Localization and synthesis of an antigenic determinant of herpes simplex virus glycoprotein D that stimulates the production of neutralizing antibody.

    ID: 1377284

    Description: epitope description:SLKMADPNRFRGKDLP antigen name:Envelope glycoprotein D host organism:Mus musculus BALB/c antibody name:170

    Publication: 6197535;

  65. Localization and synthesis of an antigenic determinant of herpes simplex virus glycoprotein D that stimulates the production of neutralizing antibody.

    ID: 1377286

    Description: epitope description:SLKMADPNRFRGKDLP antigen name:Envelope glycoprotein D host organism:Oryctolagus cuniculus New Zealand White antibody name:anti-16m...

    Publication: 6197535;

  66. Localization and synthesis of an antigenic determinant of herpes simplex virus glycoprotein D that stimulates the production of neutralizing antibody.

    ID: 1377288

    Description: epitope description:SLKMADPNRFRGKDLP antigen name:Envelope glycoprotein D host organism:Oryctolagus cuniculus New Zealand White antibody name:anti-16m...

    Publication: 6197535;

  67. Localization and synthesis of an antigenic determinant of herpes simplex virus glycoprotein D that stimulates the production of neutralizing antibody.

    ID: 1377297

    Description: epitope description:SLKMADPNRFRGKDLP antigen name:Envelope glycoprotein D host organism:Mus musculus BALB/c antibody name:170

    Publication: 6197535;

  68. Localization and synthesis of an antigenic determinant of herpes simplex virus glycoprotein D that stimulates the production of neutralizing antibody.

    ID: 1377299

    Description: epitope description:SLKMADPNRFRGKDLP antigen name:Envelope glycoprotein D host organism:Mus musculus BALB/c antibody name:anti-16mer

    Publication: 6197535;

  69. Fine structure analysis of type-specific and type-common antigenic sites of herpes simplex virus glycoprotein D.

    ID: 1377306

    Description: epitope description:KYALADASLKMADPNR antigen name:Envelope glycoprotein D host organism:Oryctolagus cuniculus antibody name:anti-gD-1

    Publication: 6208376;

  70. B-cell epitopes of varicella-zoster virus glycoprotein II.

    ID: 1377311

    Description: epitope description:HSPQKHPTRNTRSRRSVPVELRANRTITTTS antigen name:Envelope glycoprotein B host organism:Homo sapiens

    Publication: 9526550;

  71. Fine structure analysis of type-specific and type-common antigenic sites of herpes simplex virus glycoprotein D.

    ID: 1377337

    Description: epitope description:ALADPSLKMADPNRFRGKDLP host organism:Oryctolagus cuniculus antibody name:anti-gD-1

    Publication: 6208376;

  72. Fine structure analysis of type-specific and type-common antigenic sites of herpes simplex virus glycoprotein D.

    ID: 1377339

    Description: epitope description:ALADPSLKMADPNRFRGKDLP host organism:Mus musculus BALB/c antibody name:170

    Publication: 6208376;

  73. Fine structure analysis of type-specific and type-common antigenic sites of herpes simplex virus glycoprotein D.

    ID: 1377363

    Description: epitope description:KYALADASLKMADPNR antigen name:Envelope glycoprotein D host organism:Oryctolagus cuniculus New Zealand White antibody name:anti-1-1...

    Publication: 6208376;

  74. Fine structure analysis of type-specific and type-common antigenic sites of herpes simplex virus glycoprotein D.

    ID: 1377365

    Description: epitope description:KYALADPSLKMADPNR antigen name:Envelope glycoprotein D host organism:Oryctolagus cuniculus New Zealand White antibody name:anti-1-1...

    Publication: 6208376;

  75. Fine structure analysis of type-specific and type-common antigenic sites of herpes simplex virus glycoprotein D.

    ID: 1377368

    Description: epitope description:KYALADASLKMADPNR antigen name:Envelope glycoprotein D host organism:Oryctolagus cuniculus New Zealand White antibody name:anti-1-1...

    Publication: 6208376;

  76. Fine structure analysis of type-specific and type-common antigenic sites of herpes simplex virus glycoprotein D.

    ID: 1377371

    Description: epitope description:SLKMADPNRFRGKDLP antigen name:Envelope glycoprotein D host organism:Oryctolagus cuniculus New Zealand White antibody name:anti-8-2...

    Publication: 6208376;

  77. Analysis of the role of antibody-dependent cellular cytotoxic antibody activity in murine neonatal herpes simplex virus infection with antibodies to s...

    ID: 1377424

    Description: epitope description:NMGLIAGAVG antigen name:Envelope glycoprotein D host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2164044;

  78. Successful use of oligopeptides as immunogens in the preparation of antisera to immediate-early gene products of herpes simplex virus type 1.

    ID: 1377426

    Description: epitope description:PAAGTDAGEDAG antigen name:Major viral transcription factor ICP4 host organism:Oryctolagus cuniculus antibody name:anti-E175 oligop...

    Publication: 6202828;

  79. Induction of neutralizing antibody and T-cell responses to varicella-zoster virus (VZV) using Ty-virus-like particles carrying fragments of glycoprote...

    ID: 1377435

    Description: epitope description:MGTVNKPVVGVLMGFGIITG antigen name:Envelope glycoprotein E host organism:Mus musculus Swiss antibody name:mouse sera

    Publication: 9178473;

  80. Induction of neutralizing antibody and T-cell responses to varicella-zoster virus (VZV) using Ty-virus-like particles carrying fragments of glycoprote...

    ID: 1377440

    Description: epitope description:NPVRASVLRYDDFHTDEDKL antigen name:Envelope glycoprotein E host organism:Mus musculus Swiss antibody name:mouse sera

    Publication: 9178473;

  81. Induction of neutralizing antibody and T-cell responses to varicella-zoster virus (VZV) using Ty-virus-like particles carrying fragments of glycoprote...

    ID: 1377447

    Description: epitope description:SSWVNRGESSRKAYDHNSPY antigen name:Envelope glycoprotein E host organism:Mus musculus Swiss antibody name:mouse sera

    Publication: 9178473;

  82. Induction of neutralizing antibody and T-cell responses to varicella-zoster virus (VZV) using Ty-virus-like particles carrying fragments of glycoprote...

    ID: 1377460

    Description: epitope description:HEHHGVYNQGRGIDSGERLM antigen name:Envelope glycoprotein E host organism:Mus musculus Swiss antibody name:mouse sera

    Publication: 9178473;

  83. Induction of neutralizing antibody and T-cell responses to varicella-zoster virus (VZV) using Ty-virus-like particles carrying fragments of glycoprote...

    ID: 1377465

    Description: epitope description:SAQEDLGDDTGIHVIPTLNG antigen name:Envelope glycoprotein E host organism:Mus musculus Swiss antibody name:mouse sera

    Publication: 9178473;

  84. Induction of neutralizing antibody and T-cell responses to varicella-zoster virus (VZV) using Ty-virus-like particles carrying fragments of glycoprote...

    ID: 1377466

    Description: epitope description:LGDDTGIHVIPTLNGDDRHK antigen name:Envelope glycoprotein E host organism:Mus musculus Swiss antibody name:mouse sera

    Publication: 9178473;

  85. Induction of neutralizing antibody and T-cell responses to varicella-zoster virus (VZV) using Ty-virus-like particles carrying fragments of glycoprote...

    ID: 1377477

    Description: epitope description:VLMGFGIITGTLRITNPVRA antigen name:Envelope glycoprotein E host organism:Cavia porcellus Hartley antibody name:guinea pig sera

    Publication: 9178473;

  86. Induction of neutralizing antibody and T-cell responses to varicella-zoster virus (VZV) using Ty-virus-like particles carrying fragments of glycoprote...

    ID: 1377480

    Description: epitope description:NPVRASVLRYDDFHTDEDKL antigen name:Envelope glycoprotein E host organism:Cavia porcellus Hartley antibody name:guinea pig sera

    Publication: 9178473;

  87. Induction of neutralizing antibody and T-cell responses to varicella-zoster virus (VZV) using Ty-virus-like particles carrying fragments of glycoprote...

    ID: 1377494

    Description: epitope description:DHNSPYIWPRNDYDGFLENA antigen name:Envelope glycoprotein E host organism:Cavia porcellus Hartley antibody name:guinea pig sera

    Publication: 9178473;

  88. Induction of neutralizing antibody and T-cell responses to varicella-zoster virus (VZV) using Ty-virus-like particles carrying fragments of glycoprote...

    ID: 1377501

    Description: epitope description:GERLMQPTQMSAQEDLGDDT antigen name:Envelope glycoprotein E host organism:Cavia porcellus Hartley antibody name:guinea pig sera

    Publication: 9178473;

  89. Induction of neutralizing antibody and T-cell responses to varicella-zoster virus (VZV) using Ty-virus-like particles carrying fragments of glycoprote...

    ID: 1377508

    Description: epitope description:RGIDSGERLMQPTQMSAQED antigen name:Envelope glycoprotein E host organism:Cavia porcellus Hartley antibody name:guinea pig sera

    Publication: 9178473;

  90. Induction of neutralizing antibody and T-cell responses to varicella-zoster virus (VZV) using Ty-virus-like particles carrying fragments of glycoprote...

    ID: 1377522

    Description: epitope description:SRKAYDHNSPYIWPRNDYDG antigen name:Envelope glycoprotein E host organism:Mus musculus antibody name:MAb IFB9

    Publication: 9178473;

  91. Relating homology between the Epstein-Barr virus BOLF1 molecule and HLA-DQw8 beta chain to recent onset type 1 (insulin-dependent) diabetes mellitus.

    ID: 1377526

    Description: epitope description:AVTPLGPPDAEY antigen name:HLA class II histocompatibility antigen, DQ beta 1 chain (UniProt:P01920) host organism:Oryctolagus cuni...

    Publication: 1647336;

  92. Induction of neutralizing antibody and T-cell responses to varicella-zoster virus (VZV) using Ty-virus-like particles carrying fragments of glycoprote...

    ID: 1377528

    Description: epitope description:DHNSPYIWPRNDYDGFLENA antigen name:Envelope glycoprotein E host organism:Mus musculus antibody name:MAb IFB9

    Publication: 9178473;

  93. Induction of neutralizing antibody and T-cell responses to varicella-zoster virus (VZV) using Ty-virus-like particles carrying fragments of glycoprote...

    ID: 1377529

    Description: epitope description:YIWPRNDYDGFLENAHEHHG antigen name:Envelope glycoprotein E host organism:Mus musculus antibody name:MAb IFB9

    Publication: 9178473;

  94. Experimental therapy of African trypanosomiasis with a nanobody-conjugated human trypanolytic factor.

    ID: 1377703

    Description: epitope description:alpha-D-Man-(1->2)-alpha-D-Man-(1->2)-alpha-D-Man-(1->3)-[alpha-D-Man-(1->2)-alpha-D-Man-(1->3)-[alpha-D-Man-(1->2)-alpha-D-Man-(1...

    Publication: 16604085;

  95. Localization of a functional site on herpes simplex virus type 1 glycoprotein C involved in binding to cell surface heparan sulphate.

    ID: 1377735

    Description: epitope description:Q307 antigen name:Envelope glycoprotein C host organism:Mus musculus BALB/c antibody name:C11

    Publication: 7512117;

  96. Localization of a functional site on herpes simplex virus type 1 glycoprotein C involved in binding to cell surface heparan sulphate.

    ID: 1377739

    Description: epitope description:R147, G247, R145 antigen name:Envelope glycoprotein C host organism:Mus musculus BALB/c antibody name:C7, C10

    Publication: 7512117;

  97. Localization of a functional site on herpes simplex virus type 1 glycoprotein C involved in binding to cell surface heparan sulphate.

    ID: 1377753

    Description: epitope description:T150 antigen name:Envelope glycoprotein C host organism:Mus musculus BALB/c antibody name:B1C1

    Publication: 7512117;

  98. Immunogenic domains of hepatitis delta virus antigen: peptide mapping of epitopes recognized by human and woodchuck antibodies.

    ID: 1377768

    Description: epitope description:SRGAPGGGFVPSMQ antigen name:Large delta antigen host organism:Homo sapiens

    Publication: 1689390;

  99. Immunological properties of multiple repeats of a linear epitope of herpes simplex virus type 1 glycoprotein D.

    ID: 1377885

    Description: epitope description:LKMADPNRFRGKD + NLeu(M3) antigen name:Envelope glycoprotein D host organism:Mus musculus antibody name:LP14, HD-4, ID3, 170

    Publication: 2480978;

  100. Production of antibodies of predetermined specificity against herpes simplex virus DNA polymerase and their use in characterization of the enzyme.

    ID: 1377896

    Description: epitope description:DFASLYPSIIQAHNLC antigen name:DNA polymerase catalytic subunit host organism:Mus musculus BALB/c antibody name:mouse sera

    Publication: 2833607;
Displaying 100 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston