Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 5 of 1,510,353 results for " "

  1. Mutational analysis of immunoglobulin E-binding epitopes of beta-casein and beta-lactoglobulin showed a heterogeneous pattern of critical amino acids ...

    ID: 1472048

    Description: epitope description:MPIQAFLLYQEP antigen name:Bos d 11 host organism:Homo sapiens

    Publication: 17517096;

  2. Mutational analysis of immunoglobulin E-binding epitopes of beta-casein and beta-lactoglobulin showed a heterogeneous pattern of critical amino acids ...

    ID: 1472094

    Description: epitope description:AQKKIIAEKTKI antigen name:Bos d 5 host organism:Homo sapiens

    Publication: 17517096;

  3. Multi-epitope schistosome vaccine candidates tested for protective immunogenicity in mice.

    ID: 1472105

    Description: epitope description:MMNHDTESHVKISRTIYRGVSPSTT antigen name:Putative paramyosin host organism:Mus musculus CBA antibody name:mouse serum

    Publication: 10924792;

  4. IgE and IgG binding of peptides expressed from fragments of cDNA encoding the major house dust mite allergen Der p I.

    ID: 1472115

    Description: epitope description:CWAFSGVAATESAYLAHRNQSLDLAEQELVDCASQHGCHGDTIPRGI antigen name:Der p 1 host organism:Homo sapiens antibody name:patient sera

    Publication: 1940366;

  5. IgE and IgG binding of peptides expressed from fragments of cDNA encoding the major house dust mite allergen Der p I.

    ID: 1472117

    Description: epitope description:LAHRNQSLDLAEQELVDCASQHGCH antigen name:Der p 1 host organism:Homo sapiens antibody name:patient sera

    Publication: 1940366;
Displaying 5 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston