Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "

  1. Production of antibodies of predetermined specificity against herpes simplex virus DNA polymerase and their use in characterization of the enzyme.

    ID: 1377921

    Description: epitope description:MFSGGGGPLSPGGKS antigen name:DNA polymerase catalytic subunit host organism:Mus musculus BALB/c antibody name:mouse sera

    Publication: 2833607;

  2. Fine mapping of bovine herpesvirus-1 (BHV-1) glycoprotein D (gD) neutralizing epitopes by type-specific monoclonal antibodies and sequence comparison ...

    ID: 1377953

    Description: epitope description:LGAARGYTFGAC antigen name:envelope glycoprotein D host organism:Mus musculus BALB/c antibody name:MAb R54

    Publication: 7530392;

  3. Fine mapping of bovine herpesvirus-1 (BHV-1) glycoprotein D (gD) neutralizing epitopes by type-specific monoclonal antibodies and sequence comparison ...

    ID: 1377954

    Description: epitope description:LGAARGYTFGAC antigen name:envelope glycoprotein D host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7530392;

  4. Localization of epitopes of herpes simplex virus type 1 glycoprotein D.

    ID: 1377964

    Description: epitope description:HRRTRKAPKRIRLPHIR antigen name:Envelope glycoprotein D host organism:Mus musculus BALB/c antibody name:57S

    Publication: 2578577;

  5. Localization of epitopes of herpes simplex virus type 1 glycoprotein D.

    ID: 1377971

    Description: epitope description:HRRTRKAPKRIRLPHIR antigen name:Envelope glycoprotein D host organism:Oryctolagus cuniculus New Zealand White antibody name:anti-34...

    Publication: 2578577;

  6. The nature of the immunogen determines the specificity of antibodies and T cells to selected peptides of the 38 kDa mycobacterial antigen.

    ID: 1377983

    Description: epitope description:MKIRLHTLLAVLTAAPLLLA antigen name:Phosphate-binding protein PstS 1 host organism:Mus musculus C57BL/10

    Publication: 7547682;

  7. Synthesis and comparison of antibody recognition of conjugates containing herpes simplex virus type 1 glycoprotein D epitope VII.

    ID: 1404124

    Description: epitope description:LKMADPNRFRG antigen name:Envelope glycoprotein D host organism:Mus musculus antibody name:A16

    Publication: 14624643;

  8. Monoclonal antibodies to recombinant Der p 2, a major house dust mite allergen: specificity, epitope analysis and development of two-site capture ELIS...

    ID: 1404280

    Description: epitope description:NQNTKTAKIEIKASIDGLEVDVPGIDPNACHYMKCPLVKGQQYDIKYTWN antigen name:Der p 2 host organism:Mus musculus BALB/c antibody name:3B12, 2B6,...

    Publication: 10507224;

  9. Monoclonal antibodies to recombinant Der p 2, a major house dust mite allergen: specificity, epitope analysis and development of two-site capture ELIS...

    ID: 1404281

    Description: epitope description:NQNTKTAKIEIKASIDGLEVDVPGIDPNACHYMKCPLVKGQQYDIKYTWN antigen name:Der p 2 host organism:Mus musculus BALB/c antibody name:3B12, 2B6,...

    Publication: 10507224;

  10. Recognition of human cytomegalovirus by human primary immunoglobulins identifies an innate foundation to an adaptive immune response.

    ID: 1404405

    Description: epitope description:ETIYNTTLKY antigen name:Envelope glycoprotein B host organism:Homo sapiens

    Publication: 15814702;
Displaying 10 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston