Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 100 of 1,510,353 results for " "

  1. Thrombocytopenia in systemic lupus erythematosus: association with antiplatelet and anticardiolipin antibodies.

    ID: 1786183

    Description: epitope description:cardiolipin host organism:Homo sapiens

    Publication: 2340649;

  2. An N-glucosylated peptide detecting disease-specific autoantibodies, biomarkers of multiple sclerosis.

    ID: 1786187

    Description: epitope description:KNATGMEVGWYRPPFSRVVHL antigen name:Other Homo sapiens (human) protein host organism:Homo sapiens

    Publication: 16014416;

  3. A solid phase enzyme immunoassay (ELISA) for the detection and quantitation of anticardiolipin antibody.

    ID: 1786191

    Description: epitope description:cardiolipin host organism:Homo sapiens

    Publication: 3177275;

  4. Anti-phospholipid antibody isotypes in normal human sera.

    ID: 1786194

    Description: epitope description:cardiolipin host organism:Homo sapiens

    Publication: 2307490;

  5. Clinical importance of persistence of anticardiolipin antibodies in systemic lupus erythematosus.

    ID: 1786196

    Description: epitope description:cardiolipin host organism:Homo sapiens

    Publication: 2383061;

  6. Molecular basis for the preferential cleft recognition by dromedary heavy-chain antibodies.

    ID: 1786209

    Description: epitope description:R79, W80, W81, R91, L93, D119, G120, N121, N124, A125, V127, R130, K134 antigen name:Gal d 4 host organism:Camelus dromedarius ant...

    Publication: 16537393;

  7. Characteristics of high-titer IgG antiphospholipid antibody in systemic lupus erythematosus patients with and without fetal death.

    ID: 1786213

    Description: epitope description:phosphatidyl-L-serine host organism:Homo sapiens

    Publication: 2109614;

  8. Characteristics of high-titer IgG antiphospholipid antibody in systemic lupus erythematosus patients with and without fetal death.

    ID: 1786214

    Description: epitope description:phosphatidic acid host organism:Homo sapiens

    Publication: 2109614;

  9. Molecular basis for the preferential cleft recognition by dromedary heavy-chain antibodies.

    ID: 1786219

    Description: epitope description:K19, Q59, T61, Y71, N83, D84, G85, R86, N92, N95, I96, P97, C98, S99, A100, L102, S103 antigen name:Gal d 4 host organism:Camelus ...

    Publication: 16537393;

  10. Molecular basis for the preferential cleft recognition by dromedary heavy-chain antibodies.

    ID: 1786220

    Description: epitope description:K19, Q59, T61, Y71, N83, D84, G85, R86, N92, N95, I96, P97, C98, S99, A100, L102, S103 antigen name:Gal d 4 host organism:Camelus ...

    Publication: 16537393;

  11. Molecular basis for the preferential cleft recognition by dromedary heavy-chain antibodies.

    ID: 1786228

    Description: epitope description:E53, N62, R63, N64, T65, D66, D70, Q75, V127, A128, R130, N131, R132 antigen name:Gal d 4 host organism:Camelus dromedarius antibo...

    Publication: 16537393;

  12. Identification and characterization of a peptide mimetic that may detect a species of disease-associated anticardiolipin antibodies in patients with t...

    ID: 1786242

    Description: epitope description:HWDPFSLSAYFPGGGS + AMID(P12) host organism:Homo sapiens antibody name:CL15

    Publication: 12632428;

  13. High prevalence of antiphosphatidylinositol antibodies in young patients with cerebral ischemia of undetermined cause.

    ID: 1786253

    Description: epitope description:cardiolipin host organism:Homo sapiens

    Publication: 9731591;

  14. High prevalence of antiphosphatidylinositol antibodies in young patients with cerebral ischemia of undetermined cause.

    ID: 1786258

    Description: epitope description:phosphatidylcholine(1+) host organism:Homo sapiens

    Publication: 9731591;

  15. High prevalence of antiphosphatidylinositol antibodies in young patients with cerebral ischemia of undetermined cause.

    ID: 1786267

    Description: epitope description:phosphatidylglycerol host organism:Homo sapiens

    Publication: 9731591;

  16. Laboratory and clinical features in systemic lupus erythematosus patients with or without anticardiolipin antibodies.

    ID: 1786272

    Description: epitope description:cardiolipin host organism:Homo sapiens

    Publication: 1910214;

  17. Structural mechanism for affinity maturation of an anti-lysozyme antibody.

    ID: 1786277

    Description: epitope description:Q59, T61, R63, N64, T65, D66, G67, S68, T69, Y71, N83, D84, G85, R86, P88, P97, S99, L102 antigen name:Gal d 4 host organism:Mus m...

    Publication: 14988501;

  18. Relationship between antiphospholipid antibodies and recurrent fetal loss in patients with systemic lupus erythematosus and apparently healthy women.

    ID: 1786278

    Description: epitope description:cardiolipin host organism:Homo sapiens

    Publication: 2778759;

  19. Relationship between antiphospholipid antibodies and recurrent fetal loss in patients with systemic lupus erythematosus and apparently healthy women.

    ID: 1786282

    Description: epitope description:cardiolipin host organism:Homo sapiens

    Publication: 2778759;

  20. Antiphospholipid antibodies in systemic lupus erythematosus: clinical and laboratory associations in 111 patients.

    ID: 1786284

    Description: epitope description:cardiolipin host organism:Homo sapiens

    Publication: 2349437;

  21. Antiphospholipid antibodies in systemic lupus erythematosus: clinical and laboratory associations in 111 patients.

    ID: 1786285

    Description: epitope description:phosphatidyl-L-serine host organism:Homo sapiens

    Publication: 2349437;

  22. Relationship between antiphospholipid antibodies and recurrent fetal loss in patients with systemic lupus erythematosus and apparently healthy women.

    ID: 1786288

    Description: epitope description:cardiolipin host organism:Homo sapiens

    Publication: 2778759;

  23. Antiphospholipid antibodies in systemic lupus erythematosus: clinical and laboratory associations in 111 patients.

    ID: 1786289

    Description: epitope description:phosphatidylinositol host organism:Homo sapiens

    Publication: 2349437;

  24. Use of molecular simulation for mapping conformational CYP2E1 epitopes.

    ID: 1782732

    Description: epitope description:F421 antigen name:Cytochrome P450 2E1 host organism:Homo sapiens

    Publication: 15456790;

  25. Use of molecular simulation for mapping conformational CYP2E1 epitopes.

    ID: 1782736

    Description: epitope description:E440 antigen name:Cytochrome P450 2E1 host organism:Homo sapiens

    Publication: 15456790;

  26. Use of molecular simulation for mapping conformational CYP2E1 epitopes.

    ID: 1782738

    Description: epitope description:K243, E244, E248, K251 antigen name:Cytochrome P450 2E1 host organism:Homo sapiens

    Publication: 15456790;

  27. Cutaneous basophil hypersensitivity in contact-sensitized guinea pigs. I. Transfer with immune serum.

    ID: 1782804

    Description: epitope description:4-(ethoxymethylene)-2-phenyloxazol-5-one host organism:Cavia porcellus Hartley

    Publication: 4744921;

  28. Definition of Brucella A and M epitopes by monoclonal typing reagents and synthetic oligosaccharides.

    ID: 1782806

    Description: epitope description:alpha-D-Rhap4NFo-(1->2)-alpha-D-Rhap4NFo-(1->2)-alpha-D-Rhap4NFo-(1->2)-alpha-D-Rhap4NFo-(1->2)-alpha-D-Rhap4NFo-yl group antigen ...

    Publication: 2474505;

  29. Definition of Brucella A and M epitopes by monoclonal typing reagents and synthetic oligosaccharides.

    ID: 1782808

    Description: epitope description:alpha-D-Rhap4NFo-(1->3)-alpha-D-Rhap4NFo-(1->2)-alpha-D-Rhap4NFo-(1->2)-alpha-D-Rhap4NFo-(1->2)-alpha-D-Rhap4NFo-yl group antigen ...

    Publication: 2474505;

  30. Definition of Brucella A and M epitopes by monoclonal typing reagents and synthetic oligosaccharides.

    ID: 1782809

    Description: epitope description:alpha-D-Rhap4NFo-(1->2)-alpha-D-Rhap4NFo(1->3)-alpha-D-Rhap4NFo-yl group antigen name:lipopolysaccharide host organism:Mus musculu...

    Publication: 2474505;

  31. Definition of Brucella A and M epitopes by monoclonal typing reagents and synthetic oligosaccharides.

    ID: 1782811

    Description: epitope description:Brucella sp. O-PS M-antigen antigen name:lipopolysaccharide host organism:Mus musculus BALB/c antibody name:Bm3-2

    Publication: 2474505;

  32. Implications of antibodies to pyruvylated glucose in healthy populations for mycobacterioses and other infectious diseases.

    ID: 1782818

    Description: epitope description:4,6-(1'-carboxyethylidene)-3-O-methyl-beta-D-glucopyranose antigen name:GPL-8 host organism:Homo sapiens

    Publication: 2332469;

  33. Coagulation screen is more specific than the anticardiolipin antibody ELISA in defining a thrombotic subset of lupus patients.

    ID: 1782866

    Description: epitope description:cardiolipin host organism:Homo sapiens

    Publication: 3133992;

  34. High-resolution x-ray structure and functional analysis of the murine norovirus 1 capsid protein protruding domain.

    ID: 1782978

    Description: epitope description:SVTAAAS antigen name:Capsid protein VP1 host organism:Mus musculus 129 antibody name:A6.2

    Publication: 20335262;

  35. Antigenic epitopes in the hemagglutinin of Qinghai-type influenza H5N1 virus.

    ID: 1782981

    Description: epitope description:Q131, R178 antigen name:Hemagglutinin host organism:Mus musculus BALB/c antibody name:3G9

    Publication: 20373998;

  36. Antigenic epitopes in the hemagglutinin of Qinghai-type influenza H5N1 virus.

    ID: 1782982

    Description: epitope description:K129, S137 antigen name:Hemagglutinin host organism:Mus musculus BALB/c antibody name:6E2

    Publication: 20373998;

  37. Antigenic epitopes in the hemagglutinin of Qinghai-type influenza H5N1 virus.

    ID: 1782983

    Description: epitope description:I133, R178, M242 antigen name:Hemagglutinin host organism:Mus musculus BALB/c antibody name:5F12

    Publication: 20373998;

  38. Antigenic epitopes in the hemagglutinin of Qinghai-type influenza H5N1 virus.

    ID: 1782984

    Description: epitope description:P134, S136, S137 antigen name:Hemagglutinin host organism:Mus musculus BALB/c antibody name:5G9

    Publication: 20373998;

  39. Epitope specificity of anti-factor VIII antibodies from inhibitor positive acquired and congenital haemophilia A patients using synthetic peptides spa...

    ID: 1783000

    Description: epitope description:EDWDYAPLVLAPDDRSYKSQ antigen name:Coagulation factor VIII host organism:Homo sapiens

    Publication: 19404535;

  40. Epitope specificity of anti-factor VIII antibodies from inhibitor positive acquired and congenital haemophilia A patients using synthetic peptides spa...

    ID: 1783007

    Description: epitope description:LLIIFKNQASRPYNIYPHGI antigen name:Coagulation factor VIII host organism:Homo sapiens

    Publication: 19404535;

  41. Epitope specificity of anti-factor VIII antibodies from inhibitor positive acquired and congenital haemophilia A patients using synthetic peptides spa...

    ID: 1783012

    Description: epitope description:YKWTVTVEDGPTKSDPRCLT antigen name:Coagulation factor VIII host organism:Homo sapiens

    Publication: 19404535;

  42. Epitope specificity of anti-factor VIII antibodies from inhibitor positive acquired and congenital haemophilia A patients using synthetic peptides spa...

    ID: 1783024

    Description: epitope description:VFFSGYTFKHKMVYEDTLTL antigen name:Coagulation factor VIII host organism:Homo sapiens

    Publication: 19404535;

  43. Epitope specificity of anti-factor VIII antibodies from inhibitor positive acquired and congenital haemophilia A patients using synthetic peptides spa...

    ID: 1783025

    Description: epitope description:KMVYEDTLTLFPFSGETVFM antigen name:Coagulation factor VIII host organism:Homo sapiens

    Publication: 19404535;

  44. Epitope specificity of anti-factor VIII antibodies from inhibitor positive acquired and congenital haemophilia A patients using synthetic peptides spa...

    ID: 1783026

    Description: epitope description:FPFSGETVFMSMENPGLWIL antigen name:Coagulation factor VIII host organism:Homo sapiens

    Publication: 19404535;

  45. Epitope specificity of anti-factor VIII antibodies from inhibitor positive acquired and congenital haemophilia A patients using synthetic peptides spa...

    ID: 1783027

    Description: epitope description:SMENPGLWILGCHNSDFRNR antigen name:Coagulation factor VIII host organism:Homo sapiens

    Publication: 19404535;

  46. Epitope specificity of anti-factor VIII antibodies from inhibitor positive acquired and congenital haemophilia A patients using synthetic peptides spa...

    ID: 1783028

    Description: epitope description:GCHNSDFRNRGMTALLKVSS antigen name:Coagulation factor VIII host organism:Homo sapiens

    Publication: 19404535;

  47. Epitope specificity of anti-factor VIII antibodies from inhibitor positive acquired and congenital haemophilia A patients using synthetic peptides spa...

    ID: 1783030

    Description: epitope description:CDKNTGDYYEDSYEDISAYL antigen name:Coagulation factor VIII host organism:Homo sapiens

    Publication: 19404535;

  48. Epitope specificity of anti-factor VIII antibodies from inhibitor positive acquired and congenital haemophilia A patients using synthetic peptides spa...

    ID: 1783032

    Description: epitope description:LNSCSMPLGMESKAISDAQI antigen name:Coagulation factor VIII host organism:Homo sapiens

    Publication: 19404535;

  49. Epitope specificity of anti-factor VIII antibodies from inhibitor positive acquired and congenital haemophilia A patients using synthetic peptides spa...

    ID: 1783034

    Description: epitope description:TASSYFTNMFATWSPSKARL antigen name:Coagulation factor VIII host organism:Homo sapiens

    Publication: 19404535;

  50. Epitope specificity of anti-factor VIII antibodies from inhibitor positive acquired and congenital haemophilia A patients using synthetic peptides spa...

    ID: 1783035

    Description: epitope description:ATWSPSKARLHLQGRSNAWR antigen name:Coagulation factor VIII host organism:Homo sapiens

    Publication: 19404535;

  51. Epitope specificity of anti-factor VIII antibodies from inhibitor positive acquired and congenital haemophilia A patients using synthetic peptides spa...

    ID: 1783038

    Description: epitope description:QVDFQKTMKVTGVTTQGVKS antigen name:Coagulation factor VIII host organism:Homo sapiens

    Publication: 19404535;

  52. Epitope specificity of anti-factor VIII antibodies from inhibitor positive acquired and congenital haemophilia A patients using synthetic peptides spa...

    ID: 1783041

    Description: epitope description:LISSSQDGHQWTLFFQNGKV antigen name:Coagulation factor VIII host organism:Homo sapiens

    Publication: 19404535;

  53. Epitope specificity of anti-factor VIII antibodies from inhibitor positive acquired and congenital haemophilia A patients using synthetic peptides spa...

    ID: 1783042

    Description: epitope description:WTLFFQNGKVKVFQGNQDSF antigen name:Coagulation factor VIII host organism:Homo sapiens

    Publication: 19404535;

  54. Fine mapping of monoclonal antibody epitopes on human von Willebrand factor using a recombinant peptide library.

    ID: 1783073

    Description: epitope description:QPEDIFSDHHTMCYCEDGFMHCTMSGVPGSLLPDA antigen name:von Willebrand factor host organism:Mus musculus BALB/c antibody name:RG38

    Publication: 1377414;

  55. Fine mapping of monoclonal antibody epitopes on human von Willebrand factor using a recombinant peptide library.

    ID: 1783075

    Description: epitope description:DMAQVTVGPGLLGVSTL antigen name:von Willebrand factor host organism:Mus musculus BALB/c antibody name:RG49

    Publication: 1377414;

  56. Differing epitope selection of experimentally-induced and natural antibodies to a disease-specific autoantigen, the E2 subunit of pyruvate dehydrogena...

    ID: 1783085

    Description: epitope description:IETDKTSVQV antigen name:Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitocho...

    Publication: 1282029;

  57. Comparison of two different methods using overlapping synthetic peptides for localizing linear B cell epitopes in the U1 snRNP-C autoantigen.

    ID: 1783111

    Description: epitope description:MPKFYCDYCD antigen name:U1 small nuclear ribonucleoprotein C host organism:Homo sapiens

    Publication: 8960101;

  58. Comparison of two different methods using overlapping synthetic peptides for localizing linear B cell epitopes in the U1 snRNP-C autoantigen.

    ID: 1783241

    Description: epitope description:PGMMPAPHMG antigen name:U1 small nuclear ribonucleoprotein C host organism:Homo sapiens

    Publication: 8960101;

  59. Comparison of two different methods using overlapping synthetic peptides for localizing linear B cell epitopes in the U1 snRNP-C autoantigen.

    ID: 1783300

    Description: epitope description:GGHMPMMPGP antigen name:U1 small nuclear ribonucleoprotein C host organism:Homo sapiens

    Publication: 8960101;

  60. Comparison of two different methods using overlapping synthetic peptides for localizing linear B cell epitopes in the U1 snRNP-C autoantigen.

    ID: 1783309

    Description: epitope description:MPGPPMMRPP antigen name:U1 small nuclear ribonucleoprotein C host organism:Homo sapiens

    Publication: 8960101;

  61. Comparison of two different methods using overlapping synthetic peptides for localizing linear B cell epitopes in the U1 snRNP-C autoantigen.

    ID: 1783316

    Description: epitope description:MRPPARPMMV antigen name:U1 small nuclear ribonucleoprotein C host organism:Homo sapiens

    Publication: 8960101;

  62. Comparison of two different methods using overlapping synthetic peptides for localizing linear B cell epitopes in the U1 snRNP-C autoantigen.

    ID: 1783318

    Description: epitope description:MRPPARPMMV antigen name:U1 small nuclear ribonucleoprotein C host organism:Homo sapiens

    Publication: 8960101;

  63. Comparison of two different methods using overlapping synthetic peptides for localizing linear B cell epitopes in the U1 snRNP-C autoantigen.

    ID: 1783320

    Description: epitope description:PPARPMMVPT antigen name:U1 small nuclear ribonucleoprotein C host organism:Homo sapiens

    Publication: 8960101;

  64. Comparison of two different methods using overlapping synthetic peptides for localizing linear B cell epitopes in the U1 snRNP-C autoantigen.

    ID: 1783324

    Description: epitope description:ARPMMVPTRP antigen name:U1 small nuclear ribonucleoprotein C host organism:Homo sapiens

    Publication: 8960101;

  65. Comparison of two different methods using overlapping synthetic peptides for localizing linear B cell epitopes in the U1 snRNP-C autoantigen.

    ID: 1783325

    Description: epitope description:PMMVPTRPGM antigen name:U1 small nuclear ribonucleoprotein C host organism:Homo sapiens

    Publication: 8960101;

  66. Comparison of two different methods using overlapping synthetic peptides for localizing linear B cell epitopes in the U1 snRNP-C autoantigen.

    ID: 1783253

    Description: epitope description:MGGPPMMPMM antigen name:U1 small nuclear ribonucleoprotein C host organism:Homo sapiens

    Publication: 8960101;

  67. Comparison of two different methods using overlapping synthetic peptides for localizing linear B cell epitopes in the U1 snRNP-C autoantigen.

    ID: 1783256

    Description: epitope description:GPPMMPMMGP antigen name:U1 small nuclear ribonucleoprotein C host organism:Homo sapiens

    Publication: 8960101;

  68. Comparison of two different methods using overlapping synthetic peptides for localizing linear B cell epitopes in the U1 snRNP-C autoantigen.

    ID: 1783261

    Description: epitope description:PMMPMMGPPP antigen name:U1 small nuclear ribonucleoprotein C host organism:Homo sapiens

    Publication: 8960101;

  69. Comparison of two different methods using overlapping synthetic peptides for localizing linear B cell epitopes in the U1 snRNP-C autoantigen.

    ID: 1783292

    Description: epitope description:RPPMGGHMPM antigen name:U1 small nuclear ribonucleoprotein C host organism:Homo sapiens

    Publication: 8960101;

  70. Comparison of two different methods using overlapping synthetic peptides for localizing linear B cell epitopes in the U1 snRNP-C autoantigen.

    ID: 1783339

    Description: epitope description:YCDYCDTYLTHDSPSVRKTHCSGRKHKENV antigen name:U1 small nuclear ribonucleoprotein C host organism:Homo sapiens

    Publication: 8960101;

  71. Comparison of two different methods using overlapping synthetic peptides for localizing linear B cell epitopes in the U1 snRNP-C autoantigen.

    ID: 1783340

    Description: epitope description:CSGRKHKENVKDYYQK antigen name:U1 small nuclear ribonucleoprotein C host organism:Homo sapiens

    Publication: 8960101;

  72. Comparison of two different methods using overlapping synthetic peptides for localizing linear B cell epitopes in the U1 snRNP-C autoantigen.

    ID: 1783344

    Description: epitope description:KENVKDYYQKWMEEQAQS antigen name:U1 small nuclear ribonucleoprotein C host organism:Homo sapiens

    Publication: 8960101;

  73. Comparison of two different methods using overlapping synthetic peptides for localizing linear B cell epitopes in the U1 snRNP-C autoantigen.

    ID: 1783347

    Description: epitope description:KWMEEQAQSLIDKTTA antigen name:U1 small nuclear ribonucleoprotein C host organism:Homo sapiens

    Publication: 8960101;

  74. Comparison of two different methods using overlapping synthetic peptides for localizing linear B cell epitopes in the U1 snRNP-C autoantigen.

    ID: 1783350

    Description: epitope description:EQAQSLIDKTTAAFQQGKI antigen name:U1 small nuclear ribonucleoprotein C host organism:Homo sapiens

    Publication: 8960101;

  75. Comparison of two different methods using overlapping synthetic peptides for localizing linear B cell epitopes in the U1 snRNP-C autoantigen.

    ID: 1783358

    Description: epitope description:AGAMIPPPPSLPGPPR antigen name:U1 small nuclear ribonucleoprotein C host organism:Homo sapiens

    Publication: 8960101;

  76. Comparison of two different methods using overlapping synthetic peptides for localizing linear B cell epitopes in the U1 snRNP-C autoantigen.

    ID: 1783359

    Description: epitope description:AGAMIPPPPSLPGPPR antigen name:U1 small nuclear ribonucleoprotein C host organism:Homo sapiens

    Publication: 8960101;

  77. Comparison of two different methods using overlapping synthetic peptides for localizing linear B cell epitopes in the U1 snRNP-C autoantigen.

    ID: 1783361

    Description: epitope description:GPPRPGMMPAPHMGGPPMM antigen name:U1 small nuclear ribonucleoprotein C host organism:Homo sapiens

    Publication: 8960101;

  78. Comparison of two different methods using overlapping synthetic peptides for localizing linear B cell epitopes in the U1 snRNP-C autoantigen.

    ID: 1783367

    Description: epitope description:GPPPPGMMPVGPAPGMRPPMG antigen name:U1 small nuclear ribonucleoprotein C host organism:Homo sapiens

    Publication: 8960101;

  79. Comparison of two different methods using overlapping synthetic peptides for localizing linear B cell epitopes in the U1 snRNP-C autoantigen.

    ID: 1783372

    Description: epitope description:VGPAPGMRPPMGGHMPMM antigen name:U1 small nuclear ribonucleoprotein C host organism:Homo sapiens

    Publication: 8960101;

  80. Comparison of two different methods using overlapping synthetic peptides for localizing linear B cell epitopes in the U1 snRNP-C autoantigen.

    ID: 1783382

    Description: epitope description:PMMPGPPMMRPPARPMMVPTRP antigen name:U1 small nuclear ribonucleoprotein C host organism:Oryctolagus cuniculus

    Publication: 8960101;

  81. Differing epitope selection of experimentally-induced and natural antibodies to a disease-specific autoantigen, the E2 subunit of pyruvate dehydrogena...

    ID: 1783394

    Description: epitope description:TPAAT antigen name:Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial host o...

    Publication: 1282029;

  82. Comparison of two different methods using overlapping synthetic peptides for localizing linear B cell epitopes in the U1 snRNP-C autoantigen.

    ID: 1783409

    Description: epitope description:AGAMIPPPPS antigen name:U1 small nuclear ribonucleoprotein C host organism:Oryctolagus cuniculus

    Publication: 8960101;

  83. Fine mapping of monoclonal antibody epitopes on human von Willebrand factor using a recombinant peptide library.

    ID: 1783411

    Description: epitope description:QPEDIFSDHHTMCYCEDGFMHCTMSGVPGSLLPDA antigen name:von Willebrand factor host organism:Mus musculus BALB/c antibody name:RG38

    Publication: 1377414;

  84. Specific serum IgE levels and FcepsilonRIbeta genetic polymorphism in patients with penicillins allergy.

    ID: 1783419

    Description: epitope description:ampicillanyl group host organism:Homo sapiens

    Publication: 15507102;

  85. Specific serum IgE levels and FcepsilonRIbeta genetic polymorphism in patients with penicillins allergy.

    ID: 1783420

    Description: epitope description:amoxicillanyl group host organism:Homo sapiens

    Publication: 15507102;

  86. Epitope specificity of anti-factor VIII antibodies from inhibitor positive acquired and congenital haemophilia A patients using synthetic peptides spa...

    ID: 1783562

    Description: epitope description:EDWDYAPLVLAPDDRSYKSQ antigen name:Coagulation factor VIII host organism:Homo sapiens

    Publication: 19404535;

  87. Epitope specificity of anti-factor VIII antibodies from inhibitor positive acquired and congenital haemophilia A patients using synthetic peptides spa...

    ID: 1783566

    Description: epitope description:YTDETFKTREAIQHESGILG antigen name:Coagulation factor VIII host organism:Homo sapiens

    Publication: 19404535;

  88. Epitope specificity of anti-factor VIII antibodies from inhibitor positive acquired and congenital haemophilia A patients using synthetic peptides spa...

    ID: 1783571

    Description: epitope description:TDVRPLYSRRLPKGVKHLKD antigen name:Coagulation factor VIII host organism:Homo sapiens

    Publication: 19404535;

  89. Epitope specificity of anti-factor VIII antibodies from inhibitor positive acquired and congenital haemophilia A patients using synthetic peptides spa...

    ID: 1783574

    Description: epitope description:YKWTVTVEDGPTKSDPRCLT antigen name:Coagulation factor VIII host organism:Homo sapiens

    Publication: 19404535;

  90. Epitope specificity of anti-factor VIII antibodies from inhibitor positive acquired and congenital haemophilia A patients using synthetic peptides spa...

    ID: 1783576

    Description: epitope description:RYYSSFVNMERDLASGLIGP antigen name:Coagulation factor VIII host organism:Homo sapiens

    Publication: 19404535;

  91. Epitope specificity of anti-factor VIII antibodies from inhibitor positive acquired and congenital haemophilia A patients using synthetic peptides spa...

    ID: 1783578

    Description: epitope description:LLICYKESVDQRGNQIMSDK antigen name:Coagulation factor VIII host organism:Homo sapiens

    Publication: 19404535;

  92. Epitope specificity of anti-factor VIII antibodies from inhibitor positive acquired and congenital haemophilia A patients using synthetic peptides spa...

    ID: 1783579

    Description: epitope description:QRGNQIMSDKRNVILFSVFD antigen name:Coagulation factor VIII host organism:Homo sapiens

    Publication: 19404535;

  93. Epitope specificity of anti-factor VIII antibodies from inhibitor positive acquired and congenital haemophilia A patients using synthetic peptides spa...

    ID: 1783583

    Description: epitope description:VQLEDPEFQASNIMHSINGY antigen name:Coagulation factor VIII host organism:Homo sapiens

    Publication: 19404535;

  94. Epitope specificity of anti-factor VIII antibodies from inhibitor positive acquired and congenital haemophilia A patients using synthetic peptides spa...

    ID: 1783585

    Description: epitope description:SIGAQTDFLSVFFSGYTFKH antigen name:Coagulation factor VIII host organism:Homo sapiens

    Publication: 19404535;

  95. Epitope specificity of anti-factor VIII antibodies from inhibitor positive acquired and congenital haemophilia A patients using synthetic peptides spa...

    ID: 1783586

    Description: epitope description:VFFSGYTFKHKMVYEDTLTL antigen name:Coagulation factor VIII host organism:Homo sapiens

    Publication: 19404535;

  96. Epitope specificity of anti-factor VIII antibodies from inhibitor positive acquired and congenital haemophilia A patients using synthetic peptides spa...

    ID: 1783602

    Description: epitope description:LLTSMYVKEFLISSSQDGHQ antigen name:Coagulation factor VIII host organism:Homo sapiens

    Publication: 19404535;

  97. Epitope specificity of anti-factor VIII antibodies from inhibitor positive acquired and congenital haemophilia A patients using synthetic peptides spa...

    ID: 1783603

    Description: epitope description:LISSSQDGHQWTLFFQNGKV antigen name:Coagulation factor VIII host organism:Homo sapiens

    Publication: 19404535;

  98. Critical contribution of VH-VL interaction to reshaping of an antibody: the case of humanization of anti-lysozyme antibody, HyHEL-10.

    ID: 1783629

    Description: epitope description:R32, H33, G34, N37, Y38, R39, W80, W81, R91, L93, N95, T107, N111, K114, K115, I116, S118, D119, G120 antigen name:Gal d 4 host or...

    Publication: 18227432;

  99. Definition of a nonlinear conformational epitope for the apolipoprotein B-100-specific monoclonal antibody, MB47.

    ID: 1783655

    Description: epitope description:T3429, K3430, A3431, Q3432, I3433, P3434, I3435, L3436, R3437, M3438, N3439, F3440, K3441, Q3442, E3443, L3444, N3445, G3446, N344...

    Publication: 7516960;

  100. Epitope specificity of monoclonal and polyclonal antibodies to human elastin.

    ID: 1783698

    Description: epitope description:AGLGAGIP antigen name:Elastin (UniProt:P15502) host organism:Mus musculus BALB/c antibody name:G8.1

    Publication: 9430493;
Displaying 100 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston