Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. T cell recognition of hypervariable region-1 from hepatitis C virus envelope protein with multiple class II MHC molecules in mice and humans: preferen...

    ID: 1327043

    Description: epitope description:GSTAHNARTLTGMFSLGARQK antigen name:Genome polyprotein host organism:Homo sapiens antibody name:Human sera

    Publication: 9886434;

  2. Conserved group-specific epitopes of the circumsporozoite proteins revealed by antibodies to synthetic peptides.

    ID: 1335388

    Description: epitope description:RRKAHAGNKKAEDLTMDDLE antigen name:Circumsporozoite (CS) protein host organism:Oryctolagus cuniculus New Zealand White antibody nam...

    Publication: 2580025;

  3. Model multiple antigenic and homopolymeric peptides from non-repetitive sequences of malaria merozoite proteins elicit biologically irrelevant antibod...

    ID: 1335418

    Description: epitope description:NEREDERTLTKEYEDIVLK antigen name:Erythrocyte binding antigen 175 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 9989251;

  4. Model multiple antigenic and homopolymeric peptides from non-repetitive sequences of malaria merozoite proteins elicit biologically irrelevant antibod...

    ID: 1335419

    Description: epitope description:NEREDERTLTKEYEDIVLK antigen name:Erythrocyte binding antigen 175 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 9989251;

  5. Model multiple antigenic and homopolymeric peptides from non-repetitive sequences of malaria merozoite proteins elicit biologically irrelevant antibod...

    ID: 1335420

    Description: epitope description:RNNHPQNTSDSQKEATDGNK host organism:Oryctolagus cuniculus New Zealand White

    Publication: 9989251;

  6. Model multiple antigenic and homopolymeric peptides from non-repetitive sequences of malaria merozoite proteins elicit biologically irrelevant antibod...

    ID: 1335421

    Description: epitope description:RNNHPQNTSDSQKEATDGNK host organism:Oryctolagus cuniculus New Zealand White

    Publication: 9989251;

  7. Multiple non-repeated epitopes on the circumsporozoite protein of Plasmodium knowlesi.

    ID: 1335424

    Description: epitope description:PKKPNENKLKQPNE antigen name:Circumsporozoite (CS) protein host organism:Oryctolagus cuniculus antibody name:rabbit anti-N2

    Publication: 2581134;

  8. Multiple non-repeated epitopes on the circumsporozoite protein of Plasmodium knowlesi.

    ID: 1335426

    Description: epitope description:RRKAHAGNKKAEDLTMDDLE antigen name:Circumsporozoite (CS) protein host organism:Oryctolagus cuniculus antibody name:anti-sporozoite

    Publication: 2581134;

  9. Antibodies to a non-repeat region of Plasmodium falciparum antigen Pf155/RESA in individuals from malaria-endemic areas.

    ID: 1335481

    Description: epitope description:DVPYVKRVKTWRMH antigen name:Band 3 anion transport protein host organism:Homo sapiens

    Publication: 10361240;

  10. Antibodies to a non-repeat region of Plasmodium falciparum antigen Pf155/RESA in individuals from malaria-endemic areas.

    ID: 1335486

    Description: epitope description:YDSLKEKLQKTYSQY antigen name:DNAJ protein, putative host organism:Homo sapiens

    Publication: 10361240;

  11. Antibodies to a non-repeat region of Plasmodium falciparum antigen Pf155/RESA in individuals from malaria-endemic areas.

    ID: 1335490

    Description: epitope description:KEKLQKTYSQ antigen name:DNAJ protein, putative host organism:Homo sapiens

    Publication: 10361240;

  12. Antibodies to a non-repeat region of Plasmodium falciparum antigen Pf155/RESA in individuals from malaria-endemic areas.

    ID: 1335492

    Description: epitope description:EENVEENV antigen name:DNAJ protein, putative host organism:Homo sapiens

    Publication: 10361240;

  13. Antibodies to a non-repeat region of Plasmodium falciparum antigen Pf155/RESA in individuals from malaria-endemic areas.

    ID: 1335495

    Description: epitope description:INKRKYDSLKEKL antigen name:DNAJ protein, putative host organism:Homo sapiens

    Publication: 10361240;

  14. Identification of T and B cell epitopes recognized by humans in the C-terminal 42-kDa domain of the Plasmodium falciparum merozoite surface protein (M...

    ID: 1335517

    Description: epitope description:KQEGDKCVENPNPTCNENN antigen name:Merozoite surface protein 1 host organism:Homo sapiens

    Publication: 7538540;

  15. Identification of T and B cell epitopes recognized by humans in the C-terminal 42-kDa domain of the Plasmodium falciparum merozoite surface protein (M...

    ID: 1335527

    Description: epitope description:GCDADATCTEEDSGSSRKK antigen name:Merozoite surface protein 1 host organism:Homo sapiens

    Publication: 7538540;

  16. Identification of T and B cell epitopes recognized by humans in the C-terminal 42-kDa domain of the Plasmodium falciparum merozoite surface protein (M...

    ID: 1335532

    Description: epitope description:TCECTKPDSYPLFDGIFCS antigen name:Merozoite surface protein 1 host organism:Homo sapiens

    Publication: 7538540;

  17. Identification of T and B cell epitopes recognized by humans in the C-terminal 42-kDa domain of the Plasmodium falciparum merozoite surface protein (M...

    ID: 1335534

    Description: epitope description:PLFDGIFCSSSNFLGISFL antigen name:Merozoite surface protein 1 host organism:Homo sapiens

    Publication: 7538540;

  18. Isotypic analysis of Plasmodium falciparum-specific antibodies and their relation to protection in Madagascar.

    ID: 1335619

    Description: epitope description:DDEHVEEPTVA antigen name:DNAJ protein, putative host organism:Homo sapiens

    Publication: 7691751;

  19. Monoclonal antibodies that inhibit Plasmodium falciparum invasion in vitro recognise the first growth factor-like domain of merozoite surface protein-...

    ID: 1335653

    Description: epitope description:NISQHQCVKKQCPENSGCFRHLDEREECKCLLNYKQEGDKCVENPNPT antigen name:Merozoite surface protein 1 host organism:Mus musculus antibody name...

    Publication: 7694147;

  20. Pan DR binding sequence provides T-cell help for induction of protective antibodies against Plasmodium yoelii sporozoites.

    ID: 1335763

    Description: epitope description:QGPGAP antigen name:Circumsporozoite protein (UniProt:Q7RJT9) host organism:Mus musculus

    Publication: 10195633;

  21. In vivo testing of subunit vaccines against malaria sporozoites using a rodent system.

    ID: 1335764

    Description: epitope description:QGPGAPQGPGAPQGPGAP antigen name:Circumsporozoite protein (UniProt:Q7RJT9) host organism:Mus musculus BALB/c antibody name:anti-6-m...

    Publication: 3479809;

  22. Analysis of immunological nonresponsiveness to the 19-kilodalton fragment of merozoite surface Protein 1 of Plasmodium yoelii: rescue by chemical conj...

    ID: 1335770

    Description: epitope description:EPTPNAYYEGVFCSSSS antigen name:Merozoite surface protein 1 host organism:Mus musculus C57BL/10

    Publication: 14500491;

  23. In vivo testing of subunit vaccines against malaria sporozoites using a rodent system.

    ID: 1335771

    Description: epitope description:QQPPQQPPQQPPQQPP antigen name:Circumsporozoite protein (UniProt:Q7RJT9) host organism:Mus musculus BALB/c antibody name:anti-4-mer

    Publication: 3479809;

  24. In vivo testing of subunit vaccines against malaria sporozoites using a rodent system.

    ID: 1335780

    Description: epitope description:EEKKDDPPKDPKKDDPPKEA antigen name:Circumsporozoite protein (UniProt:Q7RJT9) host organism:Mus musculus BALB/c antibody name:anti-9...

    Publication: 3479809;

  25. Production and characterization of monoclonal antibodies specific for a conserved epitope within hepatitis C virus hypervariable region 1.

    ID: 1335790

    Description: epitope description:CKGLNGLFDLGPKQKI antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:2P24, 15H4

    Publication: 11711631;

  26. Production and characterization of monoclonal antibodies specific for a conserved epitope within hepatitis C virus hypervariable region 1.

    ID: 1335796

    Description: epitope description:CSGLVGLFTPGAKQNI antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:2P24, 15H4

    Publication: 11711631;

  27. Immune response in mouse and malaria-exposed humans to peptides derived from Pf11-1, a highly repetitive megadalton protein of Plasmodium falciparum.

    ID: 1335802

    Description: epitope description:YPEEVVEEVVPEEVVEEVVP host organism:Mus musculus B10.BR

    Publication: 7686855;

  28. Circumsporozoite protein of Plasmodium berghei: gene cloning and identification of the immunodominant epitopes.

    ID: 1335815

    Description: epitope description:DPAPPNANDPAPPNAND antigen name:Circumsporozoite (CS) protein, putative host organism:Mus musculus antibody name:3D11

    Publication: 2432395;

  29. Synthesis, isolation and characterization of Plasmodium falciparum antigenic tetrabranched peptide dendrimers obtained by thiazolidine linkages.

    ID: 1335818

    Description: epitope description:MIKASFDPTGAFKSPRYKSH antigen name:Apical membrane antigen 1 host organism:Oryctolagus cuniculus

    Publication: 11606215;

  30. Cellular and humoral immune responses to well-defined blood stage antigens (major merozoite surface antigen) of Plasmodium falciparum in adults from a...

    ID: 1335883

    Description: epitope description:LNDITKEYEKLLNEI antigen name:Merozoite surface protein 1 host organism:Homo sapiens

    Publication: 8300225;

  31. Human immune responses to the highly repetitive Plasmodium falciparum antigen Pf332.

    ID: 1335903

    Description: epitope description:IVEEDAPATEEIDEIE antigen name:Antigen 332, DBL-like protein host organism:Homo sapiens

    Publication: 10432071;

  32. Human immune responses to the highly repetitive Plasmodium falciparum antigen Pf332.

    ID: 1335908

    Description: epitope description:TEEIDEIESVTEEVVE antigen name:Antigen 332, DBL-like protein host organism:Homo sapiens

    Publication: 10432071;

  33. Human immune responses to the highly repetitive Plasmodium falciparum antigen Pf332.

    ID: 1335911

    Description: epitope description:SVTEEVVEEEGPVDEE antigen name:Antigen 332, DBL-like protein host organism:Homo sapiens

    Publication: 10432071;

  34. Production and characterization of monoclonal antibodies specific for a conserved epitope within hepatitis C virus hypervariable region 1.

    ID: 1335933

    Description: epitope description:CRTLTGMFSLGARQKI antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:2P24

    Publication: 11711631;

  35. Production and characterization of monoclonal antibodies specific for a conserved epitope within hepatitis C virus hypervariable region 1.

    ID: 1335948

    Description: epitope description:CTYSFVSLLSPGAKQN antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:2P24, 15H4

    Publication: 11711631;

  36. Production and characterization of monoclonal antibodies specific for a conserved epitope within hepatitis C virus hypervariable region 1.

    ID: 1335949

    Description: epitope description:CTSSLTSIFTQGAKQN antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:2P24, 15H4

    Publication: 11711631;

  37. Production and characterization of monoclonal antibodies specific for a conserved epitope within hepatitis C virus hypervariable region 1.

    ID: 1335951

    Description: epitope description:CTGGLVSLFNPGPSQD antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:2P24, 15H4

    Publication: 11711631;

  38. Production and characterization of monoclonal antibodies specific for a conserved epitope within hepatitis C virus hypervariable region 1.

    ID: 1335954

    Description: epitope description:CTQSLAGLFRPGASQN antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:2P24, 15H4

    Publication: 11711631;

  39. Production and characterization of monoclonal antibodies specific for a conserved epitope within hepatitis C virus hypervariable region 1.

    ID: 1335962

    Description: epitope description:CSGFVSLLAPGAKQN antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:2P24, 15H4

    Publication: 11711631;

  40. Production and characterization of monoclonal antibodies specific for a conserved epitope within hepatitis C virus hypervariable region 1.

    ID: 1335968

    Description: epitope description:CAALANSLSLGPQQKV antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:2P24, 15H4

    Publication: 11711631;

  41. Circumvention of MHC class II restriction by genetic immunization.

    ID: 1336007

    Description: epitope description:NANPNANPNANP antigen name:Circumsporozoite (CS) protein host organism:Mus musculus C3H

    Publication: 11672931;

  42. Identification of a major B-cell epitope of the Plasmodium falciparum glutamate-rich protein (GLURP), targeted by human antibodies mediating parasite ...

    ID: 1336018

    Description: epitope description:EIILPENVETEEIIDDVPSPKHSNHETF antigen name:Glutamate-rich protein host organism:Homo sapiens

    Publication: 10930674;

  43. Identification of a major B-cell epitope of the Plasmodium falciparum glutamate-rich protein (GLURP), targeted by human antibodies mediating parasite ...

    ID: 1336019

    Description: epitope description:DKNEKGQHEIVEVEEILPE antigen name:Glutamate-rich protein host organism:Homo sapiens

    Publication: 10930674;

  44. Identification of a major B-cell epitope of the Plasmodium falciparum glutamate-rich protein (GLURP), targeted by human antibodies mediating parasite ...

    ID: 1336021

    Description: epitope description:EIILPENVETEEIIDDVPSPKHSNHETF antigen name:Glutamate-rich protein host organism:Homo sapiens

    Publication: 10930674;

  45. Human immune responses to the highly repetitive Plasmodium falciparum antigen Pf332.

    ID: 1336071

    Description: epitope description:VQDGSVTEQIIEELF antigen name:Antigen 332, DBL-like protein host organism:Homo sapiens

    Publication: 10432071;

  46. Identification of a common Plasmodium epitope (CPE) recognised by a pan-specific inhibitory monoclonal antibody.

    ID: 1336101

    Description: epitope description:IKND antigen name:Erythrocyte membrane protein 1, PfEMP1 (UniProt:Q8IBW8) host organism:Mus musculus antibody name:M26-32

    Publication: 1723149;

  47. Quantification of antibody-secreting lymphocytes that react with Pf155/RESA from Plasmodium falciparum: an ELISPOT assay for field studies.

    ID: 1336226

    Description: epitope description:MQTLWDEIMDINKRK antigen name:DNAJ protein, putative host organism:Homo sapiens

    Publication: 8419087;

  48. Quantification of antibody-secreting lymphocytes that react with Pf155/RESA from Plasmodium falciparum: an ELISPOT assay for field studies.

    ID: 1336229

    Description: epitope description:LGRSGGDIIKKMQTL antigen name:DNAJ protein, putative host organism:Homo sapiens

    Publication: 8419087;

  49. Quantification of antibody-secreting lymphocytes that react with Pf155/RESA from Plasmodium falciparum: an ELISPOT assay for field studies.

    ID: 1336235

    Description: epitope description:MQTLWDEIMDINKRK antigen name:DNAJ protein, putative host organism:Homo sapiens

    Publication: 8419087;

  50. Human antibodies against Plasmodium falciparum liver-stage antigen 3 cross-react with Plasmodium yoelii preerythrocytic-stage epitopes and inhibit spo...

    ID: 1336237

    Description: epitope description:VESVAPSVEESVAPSVEESVA antigen name:Liver stage antigen 3 host organism:Homo sapiens

    Publication: 11349050;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston