Epitope mapping the Fim2 and Fim3 proteins of Bordetella pertussis with sera from patients infected with or vaccinated against whooping cough.

ID: 1497564

Description: epitope description:ITTYV antigen name:Serotype 2 fimbrial subunit host organism:Homo sapiens

Substrate specificity of two thrombin like enzymes (elegaxobin, elegaxobin II) from the venom of Trimeresurus elegans (Sakishima-habu), using neutrali...

ID: 1497594

Description: epitope description:HSKKVPNKDRRRRVPKEKFFCDSSKNYTKWNKDI antigen name:Thrombin-like enzyme elegaxobin-2 host organism:Oryctolagus cuniculus antibody nam...

Substrate specificity of two thrombin like enzymes (elegaxobin, elegaxobin II) from the venom of Trimeresurus elegans (Sakishima-habu), using neutrali...

ID: 1497615

Description: epitope description:LIRLNRPVRKSAHIAPLSLPSSPPSVGSVCRIM antigen name:Thrombin-like enzyme elegaxobin-2 host organism:Oryctolagus cuniculus antibody name...

Substrate specificity of two thrombin like enzymes (elegaxobin, elegaxobin II) from the venom of Trimeresurus elegans (Sakishima-habu), using neutrali...

ID: 1497645

Description: epitope description:AQPHEPGSYTNVF antigen name:Thrombin-like enzyme elegaxobin-2 host organism:Oryctolagus cuniculus antibody name:anti-elegaxobin II ...

Substrate specificity of two thrombin like enzymes (elegaxobin, elegaxobin II) from the venom of Trimeresurus elegans (Sakishima-habu), using neutrali...

ID: 1497646

Description: epitope description:SWGGDPCAQPHEPGSYTNV antigen name:Thrombin-like enzyme elegaxobin-2 host organism:Oryctolagus cuniculus antibody name:anti-elegaxob...

Localization of group-specific epitopes on the major capsid protein of group A rotavirus.

ID: 1497684

Description: epitope description:NWNFD antigen name:Intermediate capsid protein VP6 host organism:Mus musculus antibody name:RV-50, RV-1026

Epitope mapping the Fim2 and Fim3 proteins of Bordetella pertussis with sera from patients infected with or vaccinated against whooping cough.

ID: 1497713

Description: epitope description:LKLYFEP antigen name:Serotype 3 fimbrial subunit host organism:Homo sapiens

Substrate specificity of two thrombin like enzymes (elegaxobin, elegaxobin II) from the venom of Trimeresurus elegans (Sakishima-habu), using neutrali...

ID: 1497787

Description: epitope description:GQSRKPGIYTKVFDYNAWIQ antigen name:Thrombin-like enzyme flavoxobin host organism:Oryctolagus cuniculus antibody name:anti-elegaxobi...

Epitope mapping the Fim2 and Fim3 proteins of Bordetella pertussis with sera from patients infected with or vaccinated against whooping cough.

ID: 1497789

Description: epitope description:SSATK antigen name:Serotype 3 fimbrial subunit host organism:Homo sapiens

Localization of group-specific epitopes on the major capsid protein of group A rotavirus.

ID: 1497797

Description: epitope description:IRNW antigen name:Intermediate capsid protein VP6 host organism:Mus musculus antibody name:RV-133

Localization of group-specific epitopes on the major capsid protein of group A rotavirus.

ID: 1497823

Description: epitope description:LLGTTLL antigen name:Intermediate capsid protein VP6 host organism:Mus musculus antibody name:RV-133

Epitope mapping the Fim2 and Fim3 proteins of Bordetella pertussis with sera from patients infected with or vaccinated against whooping cough.

ID: 1497825

Description: epitope description:IRMGTDK antigen name:Serotype 3 fimbrial subunit host organism:Homo sapiens

Epitope mapping the Fim2 and Fim3 proteins of Bordetella pertussis with sera from patients infected with or vaccinated against whooping cough.

ID: 1497831

Description: epitope description:ASYVKKPKEDVD antigen name:Serotype 3 fimbrial subunit host organism:Homo sapiens

Epitope mapping the Fim2 and Fim3 proteins of Bordetella pertussis with sera from patients infected with or vaccinated against whooping cough.

ID: 1497852

Description: epitope description:DLIAYKQ antigen name:Serotype 3 fimbrial subunit host organism:Homo sapiens

Contribution of influenza immunity and virosomal-formulated synthetic peptide to cellular immune responses in a phase I subunit malaria vaccine trial.

ID: 1497987

Description: epitope description:ANPNENPNANPNANPNANPN + MCM(5) host organism:Homo sapiens

Substrate specificity of two thrombin like enzymes (elegaxobin, elegaxobin II) from the venom of Trimeresurus elegans (Sakishima-habu), using neutrali...

ID: 1497992

Description: epitope description:LIRLDRPVRKSAHIAPLSLPSSPPSVGSVCRVM antigen name:Thrombin-like enzyme elegaxobin-1 host organism:Oryctolagus cuniculus antibody name...

Substrate specificity of two thrombin like enzymes (elegaxobin, elegaxobin II) from the venom of Trimeresurus elegans (Sakishima-habu), using neutrali...

ID: 1497993

Description: epitope description:VIGGDECNINEHPFLVLVYYDDYQCGGTLINEEWVLTAAHCNGKN antigen name:Thrombin-like enzyme elegaxobin-1 host organism:Oryctolagus cuniculus a...

Immunobiological activities of synthetic peptide segments of fimbrial protein from Porphyromonas gingivalis.

ID: 1498016

Description: epitope description:GKTLAEVKALTTELTAENQE antigen name:Major fimbrial subunit protein type-1 host organism:Oryctolagus cuniculus

Immunobiological activities of synthetic peptide segments of fimbrial protein from Porphyromonas gingivalis.

ID: 1498022

Description: epitope description:NYTPKNKIERNHKYDIKLTI antigen name:Major fimbrial subunit protein type-1 host organism:Oryctolagus cuniculus

Substrate specificity of two thrombin like enzymes (elegaxobin, elegaxobin II) from the venom of Trimeresurus elegans (Sakishima-habu), using neutrali...

ID: 1498026

Description: epitope description:VIGGDECNINEHPFLVLVYYDDYQCGGTLINEEWVLTAAHCDGKN antigen name:Other Protobothrops elegans (sakishima habu) protein host organism:Oryc...