Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "

  1. Purification and IgE-binding epitopes of a major allergen in the gastropod Turbo cornutus.

    ID: 1405199

    Description: epitope description:SLEISEQEASQREDSYEETIRDLTQRLK antigen name:Tropomyosin host organism:Homo sapiens

    Publication: 9720216;

  2. Identification of three gp350/220 regions involved in Epstein-Barr virus invasion of host cells.

    ID: 1405238

    Description: epitope description:QVSLESVDVYFQDVFGTMWC antigen name:Envelope glycoprotein GP350 host organism:Oryctolagus cuniculus New Zealand White antibody name:...

    Publication: 16087675;

  3. Identification of three gp350/220 regions involved in Epstein-Barr virus invasion of host cells.

    ID: 1405244

    Description: epitope description:PSTSSKLRPRWTFTSPPVTT antigen name:Envelope glycoprotein GP350 host organism:Oryctolagus cuniculus New Zealand White antibody name:...

    Publication: 16087675;

  4. Identification of three gp350/220 regions involved in Epstein-Barr virus invasion of host cells.

    ID: 1405245

    Description: epitope description:QVSLESVDVYFQDVFGTMWC antigen name:Envelope glycoprotein GP350 host organism:Oryctolagus cuniculus New Zealand White antibody name:...

    Publication: 16087675;

  5. Identification of three gp350/220 regions involved in Epstein-Barr virus invasion of host cells.

    ID: 1405251

    Description: epitope description:PSTSSKLRPRWTFTSPPVTT antigen name:Envelope glycoprotein GP350 host organism:Oryctolagus cuniculus New Zealand White antibody name:...

    Publication: 16087675;

  6. Distribution of epitopes within the amino acid sequence of the Epstein-Barr virus major envelope glycoprotein, gp340, recognized by hyperimmune rabbit...

    ID: 1408106

    Description: epitope description:NPVYLIPET antigen name:Envelope glycoprotein GP350 host organism:Oryctolagus cuniculus New Zealand White antibody name:rabbit anti...

    Publication: 1376768;

  7. Molecular cloning, recombinant expression and IgE-binding epitope of omega-5 gliadin, a major allergen in wheat-dependent exercise-induced anaphylaxis...

    ID: 1408204

    Description: epitope description:QQSPEQQ antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

    Publication: 16128812;

  8. Molecular cloning, recombinant expression and IgE-binding epitope of omega-5 gliadin, a major allergen in wheat-dependent exercise-induced anaphylaxis...

    ID: 1408209

    Description: epitope description:QQPPQQ antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

    Publication: 16128812;

  9. Molecular cloning, recombinant expression and IgE-binding epitope of omega-5 gliadin, a major allergen in wheat-dependent exercise-induced anaphylaxis...

    ID: 1408210

    Description: epitope description:QQFHQQQ antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

    Publication: 16128812;

  10. Humoral and cellular immune responses to synthetic peptides of the Leishmania donovani kinetoplastid membrane protein-11.

    ID: 1408569

    Description: epitope description:MATTYEEFSAKLDRLDEEFNRKMQEQNAKFFADKPDES antigen name:Kinetoplastid membrane protein-11 host organism:Homo sapiens antibody name:Hum...

    Publication: 9714418;
Displaying 10 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston