Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 20 of 1,510,353 results for " "

  1. Localization of a conserved epitope and an azurin-like domain in the H.8 protein of pathogenic Neisseria.

    ID: 1498058

    Description: epitope description:EATPAAEAPASEAPAAEAAP antigen name:Outer membrane protein H.8 host organism:Mus musculus BALB/c antibody name:H138.2

    Publication: 2452958;

  2. A monoclonal antibody that recognizes a potential coeliac-toxic repetitive pentapeptide epitope in gliadins.

    ID: 1498062

    Description: epitope description:QQPFP antigen name:Tri a 21 host organism:Mus musculus antibody name:R5

    Publication: 11711775;

  3. Identification of previously unknown antigenic epitopes on the S and N proteins of avian infectious bronchitis virus.

    ID: 1498070

    Description: epitope description:SGGKLVGILTSRNET antigen name:Spike glycoprotein host organism:Gallus gallus

    Publication: 15868095;

  4. Identification of previously unknown antigenic epitopes on the S and N proteins of avian infectious bronchitis virus.

    ID: 1498080

    Description: epitope description:NCPYVSYGKFCIKPDGSIST antigen name:Spike glycoprotein host organism:Gallus gallus

    Publication: 15868095;

  5. The major outer membrane protein of a single Chlamydia trachomatis serovar can possess more than one serovar-specific epitope.

    ID: 1498082

    Description: epitope description:GANTE antigen name:Major outer membrane porin host organism:Mus musculus BALB/c antibody name:F5/B7

    Publication: 8550205;

  6. Identification of previously unknown antigenic epitopes on the S and N proteins of avian infectious bronchitis virus.

    ID: 1498085

    Description: epitope description:VAAKGADTKSRSNQGTRD antigen name:Nucleoprotein host organism:Gallus gallus

    Publication: 15868095;

  7. Identification of previously unknown antigenic epitopes on the S and N proteins of avian infectious bronchitis virus.

    ID: 1498086

    Description: epitope description:QAIKAKKLNVPQPKFEG antigen name:Nucleoprotein host organism:Gallus gallus

    Publication: 15868095;

  8. Identification of previously unknown antigenic epitopes on the S and N proteins of avian infectious bronchitis virus.

    ID: 1498087

    Description: epitope description:GYWRRQARYKPGKSG antigen name:Nucleoprotein host organism:Gallus gallus

    Publication: 15868095;

  9. Antigenic analysis of gonococcal pili using monoclonal antibodies.

    ID: 1498104

    Description: epitope description:PPSDIKGK antigen name:UniProt:D1DKT5 host organism:Mus musculus BALB/c antibody name:9B9/H5

    Publication: 6210338;

  10. Localization of antigenic domains on the major subunits of Bordetella pertussis serotype 2 and 3 fimbriae.

    ID: 1498109

    Description: epitope description:G84, D85, L86, I87, A88, Y89, K90, Q91, T92, Y93, T144, N145, G146, S147, K148, S149, Y150, T151, L152, R153 antigen name:Serotyp...

    Publication: 7512870;

  11. Localization of antigenic domains on the major subunits of Bordetella pertussis serotype 2 and 3 fimbriae.

    ID: 1498111

    Description: epitope description:GDLRAYKMVYATNPQTQLSN antigen name:Serotype 2 fimbrial subunit host organism:Mus musculus Porton

    Publication: 7512870;

  12. Localization of antigenic domains on the major subunits of Bordetella pertussis serotype 2 and 3 fimbriae.

    ID: 1498118

    Description: epitope description:QALGALKLYFEPGITTNYDTGDLIAYKQTYNASGN antigen name:Serotype 3 fimbrial subunit host organism:Mus musculus Porton

    Publication: 7512870;

  13. A 10-amino-acid linear sequence of VP1 of foot and mouth disease virus containing B- and T-cell epitopes induces protection in mice.

    ID: 1498137

    Description: epitope description:RGDLQVLAQK antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 7571431;

  14. The major outer membrane protein of a single Chlamydia trachomatis serovar can possess more than one serovar-specific epitope.

    ID: 1498140

    Description: epitope description:NQSTVK antigen name:Major outer membrane porin, serovar D host organism:Mus musculus BALB/c antibody name:EL11

    Publication: 8550205;

  15. Mapping of linear epitopes of the regulatory proteins of human T cell lymphotropic virus (HTLV) type II: identification of an HTLV-IIb-restricted epit...

    ID: 1498144

    Description: epitope description:SYMDTPSTCLAIVYRPIGVP antigen name:Protein Rex host organism:Homo sapiens

    Publication: 7622904;

  16. A 10-amino-acid linear sequence of VP1 of foot and mouth disease virus containing B- and T-cell epitopes induces protection in mice.

    ID: 1498153

    Description: epitope description:RYSRNAVPNV antigen name:Polyprotein host organism:Mus musculus BALB/c

    Publication: 7571431;

  17. A 10-amino-acid linear sequence of VP1 of foot and mouth disease virus containing B- and T-cell epitopes induces protection in mice.

    ID: 1498155

    Description: epitope description:VLAQKVARTLP antigen name:Polyprotein host organism:Mus musculus BALB/c

    Publication: 7571431;

  18. Mapping of linear epitopes of the regulatory proteins of human T cell lymphotropic virus (HTLV) type II: identification of an HTLV-IIb-restricted epit...

    ID: 1498165

    Description: epitope description:GRVVSSPLQYLIPRLPSFPT antigen name:Protein Tax-2 host organism:Homo sapiens

    Publication: 7622904;

  19. Mapping of linear epitopes of the regulatory proteins of human T cell lymphotropic virus (HTLV) type II: identification of an HTLV-IIb-restricted epit...

    ID: 1498172

    Description: epitope description:DDLPTTMFQPVRAPCIQTAW antigen name:Protein Tax-2 host organism:Homo sapiens

    Publication: 7622904;

  20. Mapping of linear epitopes of the regulatory proteins of human T cell lymphotropic virus (HTLV) type II: identification of an HTLV-IIb-restricted epit...

    ID: 1498173

    Description: epitope description:IQTAWCTGLLPYHSILTTPG antigen name:Protein Tax-2 host organism:Homo sapiens

    Publication: 7622904;
Displaying 20 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston