Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 5 of 1,510,353 results for " "

  1. Multi-epitope schistosome vaccine candidates tested for protective immunogenicity in mice.

    ID: 1472167

    Description: epitope description:KPQEEKEKITKEILNGK antigen name:Glutathione S-transferase class-mu 28 kDa isozyme host organism:Mus musculus CBA antibody name:mous...

    Publication: 10924792;

  2. Multi-epitope schistosome vaccine candidates tested for protective immunogenicity in mice.

    ID: 1472169

    Description: epitope description:KPQEEKEKITKEILNGK antigen name:Glutathione S-transferase class-mu 28 kDa isozyme host organism:Oryctolagus cuniculus antibody name...

    Publication: 10924792;

  3. Multi-epitope schistosome vaccine candidates tested for protective immunogenicity in mice.

    ID: 1472170

    Description: epitope description:ENLLASSPRLAKYLSNRPATPF antigen name:Glutathione S-transferase class-mu 28 kDa isozyme host organism:Mus musculus CBA antibody name...

    Publication: 10924792;

  4. Multi-epitope schistosome vaccine candidates tested for protective immunogenicity in mice.

    ID: 1472204

    Description: epitope description:KWFKTNAPNGVDEKIRI antigen name:Triosephosphate isomerase host organism:Mus musculus BALB/c antibody name:mouse serum

    Publication: 10924792;

  5. Multi-epitope schistosome vaccine candidates tested for protective immunogenicity in mice.

    ID: 1472209

    Description: epitope description:YFDGRGRAESIRMTLVAAGVDYEDERISFQDWPK antigen name:Glutathione S-transferase class-mu 28 kDa isozyme host organism:Mus musculus BALB/...

    Publication: 10924792;
Displaying 5 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston