Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "

  1. Specificity of antibodies reactive with hepatitis B surface antigen following immunization with synthetic peptides.

    ID: 1409195

    Description: epitope description:IPGSTTT antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 7508664;

  2. Structure, antigenic determinants of some clinically important insect allergens: chironomid hemoglobins.

    ID: 1410218

    Description: epitope description:IVSFLSEVISLAGSDANIPAIQNLAK antigen name:Globin CTT-VI host organism:Homo sapiens antibody name:patient sera

    Publication: 2425431;

  3. Structure, antigenic determinants of some clinically important insect allergens: chironomid hemoglobins.

    ID: 1410220

    Description: epitope description:AHINFDGPTETAWTLALDTTYAMLFSAMDS antigen name:Globin CTT-VI host organism:Homo sapiens antibody name:patient sera

    Publication: 2425431;

  4. Molecular evolution of antibody cross-reactivity for two subtypes of type A botulinum neurotoxin.

    ID: 1410242

    Description: epitope description:F953, R1064 antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus antibody name:AR2

    Publication: 17173035;

  5. Structure, antigenic determinants of some clinically important insect allergens: chironomid hemoglobins.

    ID: 1410257

    Description: epitope description:IVSFLSEVISLAGSDANIPAIQNLAK antigen name:Globin CTT-VI host organism:Homo sapiens antibody name:patient sera

    Publication: 2425431;

  6. Structure, antigenic determinants of some clinically important insect allergens: chironomid hemoglobins.

    ID: 1410260

    Description: epitope description:KAYPDIMAKFPQFAGKDLDSIKDSAAF antigen name:Globin CTT-VI host organism:Homo sapiens antibody name:patient sera

    Publication: 2425431;

  7. Crystal structure of glycoprotein B from herpes simplex virus 1.

    ID: 1410449

    Description: epitope description:R304 antigen name:Envelope glycoprotein B host organism:Mus musculus BALB/c antibody name:H1375

    Publication: 16840698;

  8. Crystal structure of glycoprotein B from herpes simplex virus 1.

    ID: 1410450

    Description: epitope description:E305 antigen name:Envelope glycoprotein B host organism:Mus musculus BALB/c antibody name:B4

    Publication: 16840698;

  9. The C terminus of component C2II of Clostridium botulinum C2 toxin is essential for receptor binding.

    ID: 1410460

    Description: epitope description:ANANRDTDRDGIPDE antigen name:Other Clostridium botulinum protein host organism:Oryctolagus cuniculus

    Publication: 10899856;

  10. The C terminus of component C2II of Clostridium botulinum C2 toxin is essential for receptor binding.

    ID: 1410461

    Description: epitope description:RLSGVFLIELDKLII antigen name:Other Clostridium botulinum protein host organism:Oryctolagus cuniculus

    Publication: 10899856;
Displaying 10 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston