Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 100 of 1,510,353 results for " "

  1. Effective inhibition of cardiolipin-binding antibodies in gram-negative infections by bacterial lipopolysaccharide.

    ID: 1790130

    Description: epitope description:cardiolipin host organism:Homo sapiens

    Publication: 3212387;

  2. Effective inhibition of cardiolipin-binding antibodies in gram-negative infections by bacterial lipopolysaccharide.

    ID: 1790136

    Description: epitope description:cardiolipin host organism:Homo sapiens

    Publication: 3212387;

  3. Effective inhibition of cardiolipin-binding antibodies in gram-negative infections by bacterial lipopolysaccharide.

    ID: 1790140

    Description: epitope description:cardiolipin host organism:Homo sapiens

    Publication: 3212387;

  4. Induction of primary antiphospholipid syndrome in mice by immunization with a human monoclonal anticardiolipin antibody (H-3).

    ID: 1790143

    Description: epitope description:cardiolipin host organism:Homo sapiens

    Publication: 1569194;

  5. Induction of primary antiphospholipid syndrome in mice by immunization with a human monoclonal anticardiolipin antibody (H-3).

    ID: 1790147

    Description: epitope description:phosphatidylinositol host organism:Homo sapiens

    Publication: 1569194;

  6. Effective inhibition of cardiolipin-binding antibodies in gram-negative infections by bacterial lipopolysaccharide.

    ID: 1790154

    Description: epitope description:lipid A host organism:Homo sapiens

    Publication: 3212387;

  7. Effective inhibition of cardiolipin-binding antibodies in gram-negative infections by bacterial lipopolysaccharide.

    ID: 1790160

    Description: epitope description:cardiolipin host organism:Homo sapiens

    Publication: 3212387;

  8. Effective inhibition of cardiolipin-binding antibodies in gram-negative infections by bacterial lipopolysaccharide.

    ID: 1790162

    Description: epitope description:cardiolipin host organism:Homo sapiens

    Publication: 3212387;

  9. Epitope mapping and immunological characterization of a major allergen TBa in tartary buckwheat.

    ID: 1790173

    Description: epitope description:RAGRINTVNSNNLPILEFLQLSAQHVVLYKNAIIGPRWNLN antigen name:Fagopyrum tataricum (Kangra buckwheat) protein host organism:Homo sapiens

    Publication: 20431913;

  10. Monoclonal antibodies against Haemophilus lipopolysaccharides: clone DP8 specific for Haemophilus ducreyi and clone DH24 binding to lacto-N-neotetraos...

    ID: 1790195

    Description: epitope description:beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp antigen name:lipopolysaccharide host organism:Mus musculus BALB/c antibody na...

    Publication: 7790083;

  11. Monoclonal antibodies against Haemophilus lipopolysaccharides: clone DP8 specific for Haemophilus ducreyi and clone DH24 binding to lacto-N-neotetraos...

    ID: 1790196

    Description: epitope description:beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp antigen name:lipopolysaccharide host organism:Mus musculus BALB/c antibody na...

    Publication: 7790083;

  12. Monoclonal antibodies against Haemophilus lipopolysaccharides: clone DP8 specific for Haemophilus ducreyi and clone DH24 binding to lacto-N-neotetraos...

    ID: 1790202

    Description: epitope description:beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp antigen name:lipopolysaccharide host organism:Mus musculus BALB/c antibody na...

    Publication: 7790083;

  13. Characterization of monoclonal antibodies recognizing three distinct, phosphorylated carbohydrate epitopes in the lipopolysaccharide of the deep rough...

    ID: 1790223

    Description: epitope description:3-deoxy-alpha-D-manno-oct-2-ulopyranosonic acid 5-phosphate antigen name:lipooligosaccharide host organism:Mus musculus BALB/c ant...

    Publication: 9044290;

  14. Anticardiolipin antibodies in Lyme disease.

    ID: 1790227

    Description: epitope description:cardiolipin host organism:Homo sapiens

    Publication: 3408508;

  15. Characterization of monoclonal anti-beta2-glycoprotein-I and anti-prothrombin antibody fragments generated by phage display from a patient with primar...

    ID: 1790240

    Description: epitope description:phosphatidyl-L-serine host organism:Homo sapiens antibody name:Beta 1, Beta 2, Prot 1

    Publication: 16330187;

  16. Determination of the epitope specificity of monoclonal antibodies against the inner core region of bacterial lipopolysaccharides by use of 3-deoxy-D-m...

    ID: 1790241

    Description: epitope description:3-deoxy-alpha-D-manno-oct-2-ulopyranosonic acid antigen name:lipopolysaccharide host organism:Mus musculus BALB/c antibody name:Cl...

    Publication: 2482126;

  17. Heat treatment of serum and plasma induces false positive results in the antiphospholipid antibody ELISA.

    ID: 1790275

    Description: epitope description:cardiolipin host organism:Homo sapiens

    Publication: 2099746;

  18. Sulfatides: targets for anti-phospholipid antibodies.

    ID: 1790292

    Description: epitope description:cardiolipin host organism:Homo sapiens

    Publication: 14530197;

  19. Anticardiolipin antibodies in D+ hemolytic uremic syndrome.

    ID: 1790314

    Description: epitope description:cardiolipin host organism:Homo sapiens

    Publication: 12478355;

  20. Enzyme-linked immunosorbent serum assays (ELISAs) for rat and human N-terminal pro-peptide of collagen type I (PINP)--assessment of corresponding epit...

    ID: 1790328

    Description: epitope description:PEEYVSPDAEVIG antigen name:Collagen alpha-1(I) chain host organism:Mus musculus BALB/c antibody name:3G1

    Publication: 20709044;

  21. Phospholipid antibodies in alcoholic liver disease.

    ID: 1790347

    Description: epitope description:phosphatidic acid host organism:Homo sapiens

    Publication: 7982646;

  22. Phospholipid antibodies in alcoholic liver disease.

    ID: 1790348

    Description: epitope description:phosphatidic acid host organism:Homo sapiens

    Publication: 7982646;

  23. Phospholipid antibodies in alcoholic liver disease.

    ID: 1790353

    Description: epitope description:phosphatidyl-L-serine host organism:Homo sapiens

    Publication: 7982646;

  24. Human antibodies reveal a protective epitope that is highly conserved among human and nonhuman influenza A viruses.

    ID: 1790356

    Description: epitope description:S2, T5, E6 antigen name:Matrix protein 2 host organism:Homo sapiens antibody name:TCN-031, TCN-032

    Publication: 20615945;

  25. Methodological approach for the detection of IgM anticardiolipin antibodies.

    ID: 1790357

    Description: epitope description:cardiolipin host organism:Homo sapiens

    Publication: 1582679;

  26. Anticardiolipin antibodies in NZW x BXSB F1 mice. A model of antiphospholipid syndrome.

    ID: 1790372

    Description: epitope description:phosphatidyl-L-serine host organism:Mus musculus NZW X BXSB antibody name:WB-CAL-1, WB-CAL-6

    Publication: 1634762;

  27. Anticardiolipin antibodies in NZW x BXSB F1 mice. A model of antiphospholipid syndrome.

    ID: 1790376

    Description: epitope description:phosphatidylinositol host organism:Mus musculus NZW X BXSB antibody name:WB-CAL-2, WB-CAL-4 and WB-CAL-5

    Publication: 1634762;

  28. Immunological property of antibodies against N-glycolylneuraminic acid epitopes in cytidine monophospho-N-acetylneuraminic acid hydroxylase-deficient ...

    ID: 1791586

    Description: epitope description:N-glycoloyl-beta-neuraminic acid antigen name:glycosphingolipid host organism:Mus musculus C57BL/6 CMAH null

    Publication: 20173026;

  29. Immunological property of antibodies against N-glycolylneuraminic acid epitopes in cytidine monophospho-N-acetylneuraminic acid hydroxylase-deficient ...

    ID: 1791588

    Description: epitope description:N-glycoloyl-beta-neuraminic acid antigen name:glycosphingolipid host organism:Mus musculus C57BL/6 CMAH null

    Publication: 20173026;

  30. Antigenic and immunogenic investigation of the virulence motif of the Newcastle disease virus fusion protein.

    ID: 1791626

    Description: epitope description:RRQKRF antigen name:Fusion glycoprotein F0 host organism:Gallus gallus White Leghorn

    Publication: 20706027;

  31. Antigenic and immunogenic investigation of the virulence motif of the Newcastle disease virus fusion protein.

    ID: 1791629

    Description: epitope description:KRQKRF antigen name:Fusion glycoprotein F0 host organism:Gallus gallus White Leghorn

    Publication: 20706027;

  32. Antigenic and immunogenic investigation of the virulence motif of the Newcastle disease virus fusion protein.

    ID: 1791631

    Description: epitope description:RRQKRF antigen name:Fusion glycoprotein F0 host organism:Gallus gallus White Leghorn

    Publication: 20706027;

  33. Effect of the alphaGal epitope on the response to small intestinal submucosa extracellular matrix in a nonhuman primate model.

    ID: 1791632

    Description: epitope description:alpha-D-Galp-(1->3)-beta-D-Galp-(1->4)-D-GlcpNAc-yl group host organism:Chlorocebus aethiops

    Publication: 19563260;

  34. Acute respiratory failure associated with catastrophic antiphospholipid syndrome.

    ID: 1791633

    Description: epitope description:cardiolipin host organism:Homo sapiens

    Publication: 10886495;

  35. Thiopalmitoylated peptides from the peripheral nervous system myelin p0 protein: synthesis, characterization, and neuritogenic properties.

    ID: 1791650

    Description: epitope description:ACKRGRQTPVLYAMLDHSRS antigen name:Myelin proteolipid protein host organism:Rattus norvegicus Lewis

    Publication: 20715848;

  36. Direct visualization of the dynamics of antigen presentation in human cells infected with cytomegalovirus revealed by antibodies mimicking TCR specifi...

    ID: 1791662

    Description: epitope description:NLVPMVATV antigen name:65 kDa phosphoprotein host organism:Homo sapiens antibody name:H9

    Publication: 20306470;

  37. Direct visualization of the dynamics of antigen presentation in human cells infected with cytomegalovirus revealed by antibodies mimicking TCR specifi...

    ID: 1791663

    Description: epitope description:NLVPMVATV antigen name:65 kDa phosphoprotein host organism:Homo sapiens antibody name:H9

    Publication: 20306470;

  38. Identification of antigen-specific residues on E2 glycoprotein of classical swine fever virus.

    ID: 1791680

    Description: epitope description:LTTTWKEYNHGLQLDDGTVRAICIAG antigen name:Genome polyprotein host organism:Mus musculus antibody name:T23

    Publication: 20558217;

  39. Mice producing less reactive oxygen species are relatively resistant to collagen glycopeptide vaccination against arthritis.

    ID: 1791688

    Description: epitope description:GIAGFKGEQGPKGEP antigen name:Collagen alpha-1(II) chain host organism:Mus musculus C57BL/10.Q

    Publication: 20686129;

  40. Recombinant peptides as new immunogens for the control of the bovine tick, Rhipicephalus (Boophilus) microplus.

    ID: 1791699

    Description: epitope description:NAWLQEPNHRNL host organism:Gallus gallus White Leghorn

    Publication: 20488622;

  41. Recombinant peptides as new immunogens for the control of the bovine tick, Rhipicephalus (Boophilus) microplus.

    ID: 1791701

    Description: epitope description:SNNADYKQSLLL host organism:Gallus gallus White Leghorn

    Publication: 20488622;

  42. Recombinant peptides as new immunogens for the control of the bovine tick, Rhipicephalus (Boophilus) microplus.

    ID: 1791714

    Description: epitope description:SSKLTFIDFHRN host organism:Gallus gallus White Leghorn

    Publication: 20488622;

  43. Recombinant peptides as new immunogens for the control of the bovine tick, Rhipicephalus (Boophilus) microplus.

    ID: 1791716

    Description: epitope description:SIPTYTPDKVTY host organism:Gallus gallus White Leghorn

    Publication: 20488622;

  44. Recombinant peptides as new immunogens for the control of the bovine tick, Rhipicephalus (Boophilus) microplus.

    ID: 1791723

    Description: epitope description:VNYNGKEHLLIP host organism:Mus musculus BALB/c

    Publication: 20488622;

  45. Recombinant peptides as new immunogens for the control of the bovine tick, Rhipicephalus (Boophilus) microplus.

    ID: 1791731

    Description: epitope description:DAWKMRLSQMYD host organism:Mus musculus BALB/c

    Publication: 20488622;

  46. Recombinant peptides as new immunogens for the control of the bovine tick, Rhipicephalus (Boophilus) microplus.

    ID: 1791749

    Description: epitope description:SIPTYTPDKVTY host organism:Bos taurus

    Publication: 20488622;

  47. Antigen-specific immunoadsorption of anti-acetylcholine receptor antibodies from sera of patients with myastenia gravis.

    ID: 1791766

    Description: epitope description:WNPDDYGGVK antigen name:Acetylcholine receptor subunit alpha (UniProt:P02708) host organism:Homo sapiens

    Publication: 20196680;

  48. Identification of B-cell epitopes in urease B subunit of Helicobacter pylori bound by neutralizing antibodies.

    ID: 1791769

    Description: epitope description:GGGTGPADGTNATTI antigen name:Urease subunit beta host organism:Mus musculus BALB/c

    Publication: 20538095;

  49. Identification of B-cell epitopes in urease B subunit of Helicobacter pylori bound by neutralizing antibodies.

    ID: 1791781

    Description: epitope description:GGGTGPADGTNATTI antigen name:Urease subunit beta host organism:Mus musculus BALB/c

    Publication: 20538095;

  50. Identification of B-cell epitopes in urease B subunit of Helicobacter pylori bound by neutralizing antibodies.

    ID: 1791783

    Description: epitope description:WMLRAAEEYSMNLGF antigen name:Urease subunit beta host organism:Mus musculus BALB/c

    Publication: 20538095;

  51. Identification of B-cell epitopes in urease B subunit of Helicobacter pylori bound by neutralizing antibodies.

    ID: 1791786

    Description: epitope description:WMLRAAEEYSMNLGF antigen name:Urease subunit beta host organism:Mus musculus antibody name:B3D9

    Publication: 20538095;

  52. Identification of B-cell epitopes in urease B subunit of Helicobacter pylori bound by neutralizing antibodies.

    ID: 1791787

    Description: epitope description:WMLRAAEEYSMNLGF antigen name:Urease subunit beta host organism:Homo sapiens

    Publication: 20538095;

  53. Identification of B-cell epitopes in urease B subunit of Helicobacter pylori bound by neutralizing antibodies.

    ID: 1791789

    Description: epitope description:WMLRAAEEYSMNLGF antigen name:Urease subunit beta host organism:Mus musculus BALB/c

    Publication: 20538095;

  54. Identification of B-cell epitopes in urease B subunit of Helicobacter pylori bound by neutralizing antibodies.

    ID: 1791794

    Description: epitope description:TLHDMGIFSITSSDS antigen name:Urease subunit beta host organism:Mus musculus antibody name:A3C10

    Publication: 20538095;

  55. Identification of B-cell epitopes in urease B subunit of Helicobacter pylori bound by neutralizing antibodies.

    ID: 1791795

    Description: epitope description:TLHDMGIFSITSSDS antigen name:Urease subunit beta host organism:Mus musculus antibody name:A3C10

    Publication: 20538095;

  56. Identification of B-cell epitopes in urease B subunit of Helicobacter pylori bound by neutralizing antibodies.

    ID: 1791797

    Description: epitope description:TLHDMGIFSITSSDS antigen name:Urease subunit beta host organism:Mus musculus BALB/c

    Publication: 20538095;

  57. Identification of B-cell epitopes in urease B subunit of Helicobacter pylori bound by neutralizing antibodies.

    ID: 1791798

    Description: epitope description:TLHDMGIFSITSSDS antigen name:Urease subunit beta host organism:Mus musculus antibody name:A3C10

    Publication: 20538095;

  58. Breaking self-tolerance toward cytochrome P4502E1 (CYP2E1) in chronic hepatitis C: possible role for molecular mimicry.

    ID: 1791802

    Description: epitope description:K342, E346 antigen name:Cytochrome P450 2E1 host organism:Homo sapiens

    Publication: 20576306;

  59. A synthetic peptide vaccine directed against the 2ß2-2ß3 loop of domain 2 of protective antigen protects rabbits from inhalation anthrax.

    ID: 1792101

    Description: epitope description:HGNAEVHASFFDIGGS antigen name:Protective antigen host organism:Oryctolagus cuniculus New Zealand White

    Publication: 20696862;

  60. Application of two different kinds of sera against the Proteus penneri lipopolysaccharide core region in search of epitopes determining cross-reaction...

    ID: 1792122

    Description: epitope description:alpha-D-GalpNAc-(1->2)-alpha-DD-Hepp-(1->6)-alpha-D-GlcpN antigen name:lipopolysaccharide host organism:Oryctolagus cuniculus New ...

    Publication: 18373243;

  61. Immunogenicity of novel Dengue virus epitopes identified by bioinformatic analysis.

    ID: 1792141

    Description: epitope description:TPPGSRDPF antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 20638434;

  62. Immunogenicity of novel Dengue virus epitopes identified by bioinformatic analysis.

    ID: 1792143

    Description: epitope description:AYRHAVEEL antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 20638434;

  63. Immunogenicity of novel Dengue virus epitopes identified by bioinformatic analysis.

    ID: 1792158

    Description: epitope description:VIPMVTQIAMTDTTP antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 20638434;

  64. Immunogenicity of novel Dengue virus epitopes identified by bioinformatic analysis.

    ID: 1792164

    Description: epitope description:TYQNKVVKVL antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 20638434;

  65. Immunogenicity of novel Dengue virus epitopes identified by bioinformatic analysis.

    ID: 1792171

    Description: epitope description:DFGSVGGVL antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 20638434;

  66. A synthetic peptide vaccine directed against the 2ß2-2ß3 loop of domain 2 of protective antigen protects rabbits from inhalation anthrax.

    ID: 1792195

    Description: epitope description:HGNAEVHASFFDIGGS antigen name:Protective antigen host organism:Macaca mulatta

    Publication: 20696862;

  67. A synthetic peptide vaccine directed against the 2ß2-2ß3 loop of domain 2 of protective antigen protects rabbits from inhalation anthrax.

    ID: 1792203

    Description: epitope description:HGNAEVHASFFDIGGS antigen name:Protective antigen host organism:Oryctolagus cuniculus New Zealand White

    Publication: 20696862;

  68. No evidence for intrathecal IgG synthesis to Epstein Barr virus nuclear antigen-1 in multiple sclerosis.

    ID: 1792214

    Description: epitope description:RERARGGSRERARGRGRGRG antigen name:Epstein-Barr nuclear antigen 1 host organism:Homo sapiens

    Publication: 20638898;

  69. No evidence for intrathecal IgG synthesis to Epstein Barr virus nuclear antigen-1 in multiple sclerosis.

    ID: 1792230

    Description: epitope description:RKKGGWFGKHRGQGGSNPKFENIAEGLRALLARSHVERTTDEGTWVAGVFVYGGSKTSLYNLRRGTALAIPQCRLTPLSRLPFGMAPGPGPQPGPLRESIVCYFMVFLQTHIFAEVLKDAIKDLVMTKPA...

    Publication: 20638898;

  70. Silicate antibodies in women with silicone breast implants: development of an assay for detection of humoral immunity.

    ID: 1792248

    Description: epitope description:sodium silicate host organism:Homo sapiens

    Publication: 8991630;

  71. Anticardiolipin antibodies from patients with the antiphospholipid antibody syndrome recognize epitopes in both beta(2)-glycoprotein 1 and oxidized lo...

    ID: 1792261

    Description: epitope description:oxidised cardiolipin host organism:Homo sapiens

    Publication: 11181467;

  72. Anticardiolipin antibodies from patients with the antiphospholipid antibody syndrome recognize epitopes in both beta(2)-glycoprotein 1 and oxidized lo...

    ID: 1792262

    Description: epitope description:oxidised cardiolipin host organism:Homo sapiens

    Publication: 11181467;

  73. Binding specificity for four monoclonal antibodies recognizing terminal Gal alpha 1-->4Gal residues in Haemophilus influenzae lipopolysaccharide.

    ID: 1792277

    Description: epitope description:alpha-D-Galp-(1->4)-beta-D-Galp antigen name:lipooligosaccharide host organism:Mus musculus BALB/c antibody name:MAHI 5, MAHI 6, M...

    Publication: 8559043;

  74. Magnitude of the hydrophobic effect at central versus peripheral sites in protein-protein interfaces.

    ID: 1792328

    Description: epitope description:H33, G34, D36, N37, Y38, R39, W81, R91, L93, T107, N111, K114, K115, S118, D119, G120 antigen name:Gal d 4 host organism:Mus muscu...

    Publication: 15698573;

  75. Magnitude of the hydrophobic effect at central versus peripheral sites in protein-protein interfaces.

    ID: 1792331

    Description: epitope description:H33, G34, D36, N37, Y38, R39, W81, R91, L93, T107, N111, K114, K115, S118, D119, G120 antigen name:Gal d 4 host organism:Mus muscu...

    Publication: 15698573;

  76. An H5N1 M2e-based multiple antigenic peptide vaccine confers heterosubtypic protection from lethal infection with pandemic 2009 H1N1 virus.

    ID: 1792338

    Description: epitope description:MSLLTEVETPTRNEWECRCSDSSD antigen name:Matrix protein 2 host organism:Mus musculus BALB/c

    Publication: 20624292;

  77. Synthetic galactocerebrosides evoke myelination-inhibiting antibodies.

    ID: 1792347

    Description: epitope description:D-galactosyl-N-tetracosanoylsphinganine host organism:Oryctolagus cuniculus New Zealand White

    Publication: 831265;

  78. Synthetic galactocerebrosides evoke myelination-inhibiting antibodies.

    ID: 1792351

    Description: epitope description:D-galactosyl-N-tetracosanoylsphinganine host organism:Oryctolagus cuniculus New Zealand White

    Publication: 831265;

  79. Synthetic galactocerebrosides evoke myelination-inhibiting antibodies.

    ID: 1792353

    Description: epitope description:D-galactosyl-N-hexadecanoylsphinganine host organism:Oryctolagus cuniculus New Zealand White

    Publication: 831265;

  80. Synthetic galactocerebrosides evoke myelination-inhibiting antibodies.

    ID: 1792363

    Description: epitope description:D-glucosyl-N-tetracosanoylsphinganine host organism:Oryctolagus cuniculus New Zealand White

    Publication: 831265;

  81. 3D structure determination of STARP peptides implicated in P. falciparum invasion of hepatic cells.

    ID: 1792374

    Description: epitope description:VIKHMRFHVDYQIAFLGGGY host organism:Aotus

    Publication: 20580741;

  82. Chimeric vaccine composed of viral peptide and mammalian heat-shock protein 60 peptide protects against West Nile virus challenge.

    ID: 1792410

    Description: epitope description:LVTVNPFVSVATANS antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 20331473;

  83. A variable region in GP4 of European-type porcine reproductive and respiratory syndrome virus induces neutralizing antibodies against homologous but n...

    ID: 1792437

    Description: epitope description:THLSDIETNTTA antigen name:Glycoprotein 4 host organism:Sus scrofa

    Publication: 20712485;

  84. A variable region in GP4 of European-type porcine reproductive and respiratory syndrome virus induces neutralizing antibodies against homologous but n...

    ID: 1792456

    Description: epitope description:DINCFRPHGVSA antigen name:Glycoprotein 4 host organism:Sus scrofa

    Publication: 20712485;

  85. A variable region in GP4 of European-type porcine reproductive and respiratory syndrome virus induces neutralizing antibodies against homologous but n...

    ID: 1792458

    Description: epitope description:GVSAAQEKISFG antigen name:Glycoprotein 4 host organism:Sus scrofa

    Publication: 20712485;

  86. A variable region in GP4 of European-type porcine reproductive and respiratory syndrome virus induces neutralizing antibodies against homologous but n...

    ID: 1792461

    Description: epitope description:KSSQCREAVGTP antigen name:Glycoprotein 4 host organism:Sus scrofa

    Publication: 20712485;

  87. A variable region in GP4 of European-type porcine reproductive and respiratory syndrome virus induces neutralizing antibodies against homologous but n...

    ID: 1792462

    Description: epitope description:CREAVGTPQYIT antigen name:Glycoprotein 4 host organism:Sus scrofa

    Publication: 20712485;

  88. A variable region in GP4 of European-type porcine reproductive and respiratory syndrome virus induces neutralizing antibodies against homologous but n...

    ID: 1792476

    Description: epitope description:YASEMSEKGFKV antigen name:Glycoprotein 4 host organism:Sus scrofa

    Publication: 20712485;

  89. A variable region in GP4 of European-type porcine reproductive and respiratory syndrome virus induces neutralizing antibodies against homologous but n...

    ID: 1792486

    Description: epitope description:HHLVIDHIRLLH antigen name:Glycoprotein 4 host organism:Sus scrofa

    Publication: 20712485;

  90. A variable region in GP4 of European-type porcine reproductive and respiratory syndrome virus induces neutralizing antibodies against homologous but n...

    ID: 1792495

    Description: epitope description:GVSAAQEKISFG antigen name:Glycoprotein 4 host organism:Sus scrofa

    Publication: 20712485;

  91. Study of procainamide hapten-specific antibodies in rabbits and humans.

    ID: 1792680

    Description: epitope description:procainamide hydrochloride host organism:Oryctolagus cuniculus New Zealand White

    Publication: 8253539;

  92. Combinatorial peptides directed to inhibitory antibodies against human blood clotting factor VIII.

    ID: 1792712

    Description: epitope description:RHYKQYQFHF host organism:Homo sapiens

    Publication: 16363233;

  93. Combinatorial peptides directed to inhibitory antibodies against human blood clotting factor VIII.

    ID: 1792717

    Description: epitope description:PYYRWQYKYD host organism:Mus musculus antibody name:Mab038

    Publication: 16363233;

  94. Antiphospholipid antibodies enhance thrombin-induced platelet activation and thromboxane formation.

    ID: 1792721

    Description: epitope description:cardiolipin host organism:Homo sapiens

    Publication: 8115993;

  95. Serum monoclonal antibodies derived from patients with multiple myeloma react with mycobacterial phosphoinositides and nuclear antigens.

    ID: 1792731

    Description: epitope description:cardiolipin host organism:Homo sapiens antibody name:P429, P557

    Publication: 2546701;

  96. Serum monoclonal antibodies derived from patients with multiple myeloma react with mycobacterial phosphoinositides and nuclear antigens.

    ID: 1792743

    Description: epitope description:trehalose monomycolate host organism:Homo sapiens antibody name:P429

    Publication: 2546701;

  97. Identification of antigen-specific residues on E2 glycoprotein of classical swine fever virus.

    ID: 1792770

    Description: epitope description:LTTTWKEYNHGLQLDDGTVRAICIAG antigen name:Genome polyprotein host organism:Mus musculus antibody name:V8

    Publication: 20558217;

  98. Study of procainamide hapten-specific antibodies in rabbits and humans.

    ID: 1792786

    Description: epitope description:procainamide 4-hydroxylamine host organism:Oryctolagus cuniculus New Zealand White

    Publication: 8253539;

  99. Significance of anti-phospholipid antibodies in patients with lupus nephritis.

    ID: 1792796

    Description: epitope description:cardiolipin host organism:Homo sapiens

    Publication: 1716712;

  100. Study of procainamide hapten-specific antibodies in rabbits and humans.

    ID: 1792803

    Description: epitope description:procainamide hydrochloride host organism:Oryctolagus cuniculus New Zealand White

    Publication: 8253539;
Displaying 100 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston