Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Antigenic heterogeneity of the hepatitis C virus NS4 protein as modeled with synthetic peptides.

    ID: 1335018

    Description: epitope description:GRLHINQRTVVAPDKEVLYE antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10208931;

  2. Antigenic heterogeneity of the hepatitis C virus NS4 protein as modeled with synthetic peptides.

    ID: 1335026

    Description: epitope description:ALLEEGQRIAEMLKSKIQGL antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10208931;

  3. Antigenic heterogeneity of the hepatitis C virus NS4 protein as modeled with synthetic peptides.

    ID: 1335031

    Description: epitope description:GRVVLSGQPAVIPDREVLYQ antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10208931;

  4. Antigenic heterogeneity of the hepatitis C virus NS4 protein as modeled with synthetic peptides.

    ID: 1335033

    Description: epitope description:PAVIPDREVLYQQFDEMEEC antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10208931;

  5. Antigenic heterogeneity of the hepatitis C virus NS4 protein as modeled with synthetic peptides.

    ID: 1335034

    Description: epitope description:PDREVLYQQFDEMEECSKHL antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10208931;

  6. Antigenic heterogeneity of the hepatitis C virus NS4 protein as modeled with synthetic peptides.

    ID: 1335045

    Description: epitope description:LTGKPAVVPDREILYQQFDE antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10208931;

  7. Antigenic heterogeneity of the hepatitis C virus NS4 protein as modeled with synthetic peptides.

    ID: 1335046

    Description: epitope description:PAVVPDREILYQQFDEMEEC antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10208931;

  8. Antigenic heterogeneity of the hepatitis C virus NS4 protein as modeled with synthetic peptides.

    ID: 1335051

    Description: epitope description:SRHIPYLAEGQQIAEQFRQK antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10208931;

  9. Antigenic heterogeneity of the hepatitis C virus NS4 protein as modeled with synthetic peptides.

    ID: 1335052

    Description: epitope description:PYLAEGQQIAEQFRQKVLGL antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10208931;

  10. Antigenic heterogeneity of the hepatitis C virus NS4 protein as modeled with synthetic peptides.

    ID: 1335056

    Description: epitope description:VLGLLQASAKQAEELKPAV antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10208931;

  11. Antigenic heterogeneity of the hepatitis C virus NS4 protein as modeled with synthetic peptides.

    ID: 1335061

    Description: epitope description:NRLIAFASRGNHDSPTHYV antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10208931;

  12. Antigenic heterogeneity of the hepatitis C virus NS4 protein as modeled with synthetic peptides.

    ID: 1335063

    Description: epitope description:SRGNHDSPTHYVPESDAAAR antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10208931;

  13. Antigenic heterogeneity of the hepatitis C virus NS4 protein as modeled with synthetic peptides.

    ID: 1335077

    Description: epitope description:PESEPAARVTQILSSLTITQ antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10208931;

  14. Antigenic heterogeneity of the hepatitis C virus NS4 protein as modeled with synthetic peptides.

    ID: 1335078

    Description: epitope description:PAARVTQILSSLTITQLLKR antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10208931;

  15. Antigenic heterogeneity of the hepatitis C virus NS4 protein as modeled with synthetic peptides.

    ID: 1335084

    Description: epitope description:AFAFAGNHVSPTHYVPESDA antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10208931;

  16. Antigenic heterogeneity of the hepatitis C virus NS4 protein as modeled with synthetic peptides.

    ID: 1335089

    Description: epitope description:AAARVTQILSSLTITQLLKR antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10208931;

  17. Antigenic heterogeneity of the hepatitis C virus NS4 protein as modeled with synthetic peptides.

    ID: 1335091

    Description: epitope description:HVGPGEGAVQWMNRLIAFAS antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10208931;

  18. Antigenic heterogeneity of the hepatitis C virus NS4 protein as modeled with synthetic peptides.

    ID: 1335094

    Description: epitope description:NRLIAFASRGNHVAPTHYVT antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10208931;

  19. Antigenic heterogeneity of the hepatitis C virus NS4 protein as modeled with synthetic peptides.

    ID: 1335095

    Description: epitope description:AFASRGNHVAPTHYVTESD antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10208931;

  20. Antigenic heterogeneity of the hepatitis C virus NS4 protein as modeled with synthetic peptides.

    ID: 1335099

    Description: epitope description:TESDASQRVTQLLGSLTITS antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10208931;

  21. Antigenic heterogeneity of the hepatitis C virus NS4 protein as modeled with synthetic peptides.

    ID: 1335103

    Description: epitope description:GEGAVQWMNRLIAFASRGNH antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10208931;

  22. Antigenic heterogeneity of the hepatitis C virus NS4 protein as modeled with synthetic peptides.

    ID: 1335110

    Description: epitope description:VESDASQRVTQVLSSLTITS antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10208931;

  23. Antigenic heterogeneity of the hepatitis C virus NS4 protein as modeled with synthetic peptides.

    ID: 1335111

    Description: epitope description:ASQRVTQVLSSLTITSLLRR antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10208931;

  24. Antigenic heterogeneity of the hepatitis C virus NS4 protein as modeled with synthetic peptides.

    ID: 1335117

    Description: epitope description:AFASRGNHVSPTHYVPESDA antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10208931;

  25. Antigenic heterogeneity of the hepatitis C virus NS4 protein as modeled with synthetic peptides.

    ID: 1335129

    Description: epitope description:SRGNHVSPAHYVPESDAAAR antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10208931;

  26. Cellular and antibody responses to the Plasmodium falciparum heat shock protein Pf72/HSP70 during and after acute malaria in individuals from an endem...

    ID: 1335171

    Description: epitope description:SKIYQDAAGAAGGMPG antigen name:Heat shock 70 kDa protein host organism:Homo sapiens

    Publication: 10379811;

  27. Comparison of analytical methods for the evaluation of antibody responses against epitopes of polymorphic protein antigens.

    ID: 1335188

    Description: epitope description:YGLFQKEKMVL antigen name:Merozoite surface protein 1 host organism:Mus musculus C57BL/6 human IgCkappa Tg antibody name:7.19

    Publication: 12738356;

  28. Comparison of analytical methods for the evaluation of antibody responses against epitopes of polymorphic protein antigens.

    ID: 1335192

    Description: epitope description:YGLFHKEKMIL antigen name:Merozoite surface protein 1 host organism:Mus musculus C57BL/6 human IgCkappa Tg antibody name:7.27

    Publication: 12738356;

  29. MSP-1 malaria pseudopeptide analogs: biological and immunological significance and three-dimensional structure.

    ID: 1335214

    Description: epitope description:EVLYLKPLAGVYRSLKKQLE + MCM(K6, P7) antigen name:Merozoite surface protein 1 host organism:Mus musculus BALB/c antibody name:Mouse ...

    Publication: 12674501;

  30. Stable expression and secretion of the B-cell epitope of rodent malaria from Mycobacterium bovis BCG and induction of long-lasting humoral response in...

    ID: 1335230

    Description: epitope description:PQGPGAPQGPGAPQGPGAP antigen name:Circumsporozoite protein (UniProt:Q7RJT9) host organism:Oryctolagus cuniculus

    Publication: 8821650;

  31. Comparison of analytical methods for the evaluation of antibody responses against epitopes of polymorphic protein antigens.

    ID: 1335276

    Description: epitope description:YGLFHKEKMIL antigen name:Merozoite surface protein 1 host organism:Mus musculus C57BL/6 human IgCkappa Tg antibody name:7.19

    Publication: 12738356;

  32. Comparison of analytical methods for the evaluation of antibody responses against epitopes of polymorphic protein antigens.

    ID: 1335277

    Description: epitope description:YGLFHKEKMLL antigen name:Merozoite surface protein 1 host organism:Mus musculus C57BL/6 human IgCkappa Tg antibody name:7.27

    Publication: 12738356;

  33. Comparison of analytical methods for the evaluation of antibody responses against epitopes of polymorphic protein antigens.

    ID: 1335278

    Description: epitope description:YGLFHKEKMLL antigen name:Merozoite surface protein 1 host organism:Mus musculus C57BL/6 human IgCkappa Tg antibody name:7.19

    Publication: 12738356;

  34. A conserved peptide sequence of the Plasmodium falciparum circumsporozoite protein and antipeptide antibodies inhibit Plasmodium berghei sporozoite in...

    ID: 1335350

    Description: epitope description:IEQYLKKIKNSISTEWSPCSVTCGNGIQVRIK antigen name:Circumsporozoite (CS) protein host organism:Mus musculus C57BL/6

    Publication: 7591073;

  35. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328280

    Description: epitope description:LPLRGKLSFWEAGTTKAGYPYNYNT antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  36. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328282

    Description: epitope description:LAPHSALALLEDTMDYPARAHTFDD antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  37. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328285

    Description: epitope description:CPECRPLGLQGCAFQSTVAELQRLK antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  38. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328298

    Description: epitope description:DSRGAILRRQYNLSTSPLTSSVATG antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  39. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328299

    Description: epitope description:RQYNLSTSPLTSSVATGTNLVLYAA antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  40. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328302

    Description: epitope description:VPNAVGGYAISISFWPQTTTTPTSV antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  41. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328303

    Description: epitope description:SISFWPQTTTTPTSVDMNSITSTDV antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  42. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328309

    Description: epitope description:RHRLRRGADGTAELTTTAATRFMKD antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  43. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328311

    Description: epitope description:PTVKLYTSVENAQQDKGIAIPHDID antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  44. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328315

    Description: epitope description:SRVVIQDYDNQHEQDRPTPSPAPSR antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  45. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328317

    Description: epitope description:GPVYVSDSVTLVNVATGAQAVARSL antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  46. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328320

    Description: epitope description:TTKAGYPYNYNTTASDQLLVENAAG antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  47. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328323

    Description: epitope description:HTFDDFCPECRPLGLQGCAFQSTVA antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  48. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328328

    Description: epitope description:GSGGGFWGDRVDSQPFAI antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  49. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328338

    Description: epitope description:YSRPVVSANGEPTVKLYT antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  50. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328368

    Description: epitope description:VLPLRGKLSFWEAGTTKAGYPYNYNTTASD antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston