Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "
  1. The C terminus of component C2II of Clostridium botulinum C2 toxin is essential for receptor binding.

    ID: 1410464

    Description: epitope description:FKENISSINIINDTNFGVQSMTGLSNRSKGQDGIYRAATTAFSFKSKELKYPEGRYRMRFVIQSYEPFTCNFKLFNNLIYSSSFDKGYYDEFFYFYYNGSKSFFNISCDIINSINRLSGVFLIELDKLII...

    Publication: 10899856;
  2. The C terminus of component C2II of Clostridium botulinum C2 toxin is essential for receptor binding.

    ID: 1410481

    Description: epitope description:MLVSKFENSVKNSNKNYFTINGLMGYYFENDFFNLNIISPTLDGNLTFSKEDINSILGNKIIKSARWIGLIKPSITGEYILSTNSPNCRVELNGEIFNLSLNTSNTVNLIQGNVYDIRIEQLMSENQLLK...

    Publication: 10899856;
  3. The C terminus of component C2II of Clostridium botulinum C2 toxin is essential for receptor binding.

    ID: 1410483

    Description: epitope description:MLVSKFENSVKNSNKNYFTINGLMGYYFENDFFNLNIISPTLDGNLTFSKEDINSILGNKIIKSARWIGLIKPSITGEYILSTNSPNCRVELNGEIFNLSLNTSNTVNLIQGNVYDIRIEQLMSENQLLK...

    Publication: 10899856;
  4. Characterization of murine monoclonal and murine, rabbit, and human polyclonal antibodies against chlamydial lipopolysaccharide.

    ID: 1410594

    Description: epitope description:alpha-Kdo-(2->4)-alpha-Kdo antigen name:lipopolysaccharide host organism:Oryctolagus cuniculus

    Publication: 2294050;
  5. Treatment of cat allergy with T-cell reactive peptides.

    ID: 1410604

    Description: epitope description:KRDVDLFLTGTPDEYVEQVAQYKALPV antigen name:Fel d 1 host organism:Homo sapiens

    Publication: 8970345;
  6. Characterization of murine monoclonal and murine, rabbit, and human polyclonal antibodies against chlamydial lipopolysaccharide.

    ID: 1410605

    Description: epitope description:3-deoxy-alpha-D-manno-oct-2-ulopyranosonic acid antigen name:lipopolysaccharide host organism:Mus musculus BALB/c

    Publication: 2294050;
  7. Structural and functional complexity of the humoral response against the Trypanosoma cruzi ribosomal P2 beta protein in patients with chronic Chagas' ...

    ID: 1410811

    Description: epitope description:EESDDDMGFGLFD antigen name:60S acidic ribosomal protein P2 host organism:Homo sapiens

    Publication: 15147356;
  8. Structural and functional complexity of the humoral response against the Trypanosoma cruzi ribosomal P2 beta protein in patients with chronic Chagas' ...

    ID: 1410812

    Description: epitope description:EEEDDDMGFGLFD antigen name:Other Trypanosoma cruzi protein host organism:Homo sapiens

    Publication: 15147356;
  9. Treatment of cat allergy with T-cell reactive peptides.

    ID: 1410814

    Description: epitope description:KALPVVLENARILKNCVDAKMTEEDKE antigen name:Fel d 1 host organism:Homo sapiens

    Publication: 8970345;
  10. Mapping of conformational IgE epitopes on Phl p 5a by using mimotopes from a phage display library.

    ID: 1411228

    Description: epitope description:SRLGRSSAWV host organism:Homo sapiens antibody name:anti-Phl p 5

    Publication: 15577826;

Displaying 10 of 1,510,353 results for " "