Analysis of epitope-specific immune responses induced by vaccination with structurally folded and unfolded recombinant Bet v 1 allergen derivatives in...

ID: 1494375

Description: epitope description:GPGTIKKISFPEGFPFKYVKDRVDEVDHTN antigen name:Bet v 1 host organism:Homo sapiens

Analysis of epitope-specific immune responses induced by vaccination with structurally folded and unfolded recombinant Bet v 1 allergen derivatives in...

ID: 1494378

Description: epitope description:GPGTIKKISFPEGFPFKYVKDRVDEVDHTN antigen name:Bet v 1 host organism:Homo sapiens

Analysis of epitope-specific immune responses induced by vaccination with structurally folded and unfolded recombinant Bet v 1 allergen derivatives in...

ID: 1494383

Description: epitope description:DGGSILKISNKYHTKGDHEVKAEQVKASKE antigen name:Bet v 1 host organism:Homo sapiens

Analysis of epitope-specific immune responses induced by vaccination with structurally folded and unfolded recombinant Bet v 1 allergen derivatives in...

ID: 1494385

Description: epitope description:DGGSILKISNKYHTKGDHEVKAEQVKASKE antigen name:Bet v 1 host organism:Homo sapiens

Analysis of epitope-specific immune responses induced by vaccination with structurally folded and unfolded recombinant Bet v 1 allergen derivatives in...

ID: 1494387

Description: epitope description:KAEQVKASKEMGETLLRAVESYLLAHSDAYN antigen name:Bet v 1 host organism:Homo sapiens

Analysis of epitope-specific immune responses induced by vaccination with structurally folded and unfolded recombinant Bet v 1 allergen derivatives in...

ID: 1494390

Description: epitope description:VDHTNFKYNYSVIEGGPIGDTLEKISNEIK antigen name:Bet v 1 host organism:Homo sapiens

Analysis of epitope-specific immune responses induced by vaccination with structurally folded and unfolded recombinant Bet v 1 allergen derivatives in...

ID: 1494391

Description: epitope description:VDHTNFKYNYSVIEGGPIGDTLEKISNEIK antigen name:Bet v 1 host organism:Homo sapiens

The latex allergen hev B 5 is an antigen with repetitive murine B-cell epitopes.

ID: 1494405

Description: epitope description:PAEGEK antigen name:Hev b 5 host organism:Mus musculus BALB/c antibody name:3G3, 6A10, 6F6

Immunisation with phage-displayed variable region 2 from meningococcal PorA outer membrane protein induces bactericidal antibodies against Neisseria m...

ID: 1494408

Description: epitope description:PIQNSKSAYTPAHYTRQNNADVFVPAVVGKPGS antigen name:Major outer membrane protein P.IA host organism:Mus musculus BALB/c

Immunisation with phage-displayed variable region 2 from meningococcal PorA outer membrane protein induces bactericidal antibodies against Neisseria m...

ID: 1494409

Description: epitope description:PIQNSKSAYTPAHYTRQNNADVFVPAVVGKPGS antigen name:Major outer membrane protein P.IA host organism:Mus musculus BALB/c

Generation of monoclonal antibodies against human prion proteins in PrP0/0 mice.

ID: 1494410

Description: epitope description:RYPGQGSPGGNRYPPQG antigen name:Major prion protein host organism:Mus musculus PrP null antibody name:mab 4F2

A conjugate vaccine composed of a heat shock protein 60 T-cell epitope peptide (p458) and Neisseria meningitidis type B capsular polysaccharide.

ID: 1494413

Description: epitope description:NEDQKIGIEIIKRALKI antigen name:60 kDa heat shock protein, mitochondrial host organism:Mus musculus BALB/c

Exploring computational lead optimisation with affinity constants obtained by surface plasmon resonance for the interaction of PorA epitope peptides w...

ID: 1494434

Description: epitope description:DTNNN antigen name:Major outer membrane protein P.IA host organism:Mus musculus antibody name:MN12H2

A hypoallergenic vaccine obtained by tail-to-head restructuring of timothy grass pollen profilin, Phl p 12, for the treatment of cross-sensitization t...

ID: 1494439

Description: epitope description:MKDFDEPGHLAPTGMFVAGAKYMVIQG antigen name:Phl p 12 host organism:Mus musculus BALB/c

Generation of recombinant monoclonal antibodies to study structure-function of envelope protein VP28 of white spot syndrome virus from shrimp.

ID: 1494464

Description: epitope description:RYHNTVTKTIETHTDNIETNMDENLRIPVTAEVGSGYFKM antigen name:Wsv421 host organism:Mus musculus BALB/c antibody name:P108D2, P111B10

Generation of recombinant monoclonal antibodies to study structure-function of envelope protein VP28 of white spot syndrome virus from shrimp.

ID: 1494468

Description: epitope description:SDAQMKE antigen name:Wsv421 host organism:Mus musculus BALB/c antibody name:P108B4

Generation of recombinant monoclonal antibodies to study structure-function of envelope protein VP28 of white spot syndrome virus from shrimp.

ID: 1494469

Description: epitope description:SDAQMKE antigen name:Wsv421 host organism:Mus musculus BALB/c antibody name:P108B4

Construction of hevein (Hev b 6.02) with reduced allergenicity for immunotherapy of latex allergy by comutation of six amino acid residues on the conf...

ID: 1494479

Description: epitope description:E29 antigen name:Hev b 6 host organism:Homo sapiens

Construction of hevein (Hev b 6.02) with reduced allergenicity for immunotherapy of latex allergy by comutation of six amino acid residues on the conf...

ID: 1494482

Description: epitope description:Q38 antigen name:Hev b 6 host organism:Homo sapiens

Mapping of the antigenic regions of streptokinase in humans after streptokinase therapy.

ID: 1494509

Description: epitope description:VSVAGTVEGTNQDISLKFFE antigen name:Streptokinase host organism:Homo sapiens