Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328378

    Description: epitope description:LHYRNQGWRSVETSGVAEEEATSGL antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  2. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328384

    Description: epitope description:RHRLRRGADGTAELTTTAATRFMKD antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  3. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328387

    Description: epitope description:GLPTELISSAGGQLFYSRPVVSANG antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  4. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328388

    Description: epitope description:IPHDIDLGESRVVIQDYDNQHEQDR antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  5. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328393

    Description: epitope description:TLVNVATGAQAVARSLDWTKVTLDG antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  6. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328407

    Description: epitope description:PDVTAAAGAGPRVRQPAR antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  7. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328408

    Description: epitope description:VRQPARPLGSAWRDQAQR antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  8. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328410

    Description: epitope description:PAHDTPPVPDVDSRGAIL antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  9. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328411

    Description: epitope description:SRGAILRRQYNLSTSPLT antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  10. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328413

    Description: epitope description:SPLTSSVATGTNLVLYAA antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  11. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328420

    Description: epitope description:AISISFWPQTTTTPTSVD antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  12. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328430

    Description: epitope description:LLDFALELEFRNLTPGNT antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  13. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328432

    Description: epitope description:FRNLTPGNTNTRVSRYSS antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  14. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328435

    Description: epitope description:HRLRRGADGTAELTTTAA antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  15. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328437

    Description: epitope description:TAATRFMKDLYFTSTNGV antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  16. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328438

    Description: epitope description:NGVGEIGRGIALTLFNLA antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  17. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328443

    Description: epitope description:EQDRPTPSPAPSRPFSVL antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  18. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328446

    Description: epitope description:RANDVLWLSLTAAEYDQS antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  19. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328466

    Description: epitope description:APLSPLLPLQDGTNTHIMATEASNY antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  20. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328468

    Description: epitope description:TDVRILVQPGIASELVIPSERLHYR antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  21. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328473

    Description: epitope description:RYSSTARHRLRRGADGTAELTTTAA antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  22. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328481

    Description: epitope description:PFSVLRANDVLWLSLTAAEYDQSTY antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  23. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328485

    Description: epitope description:LDGRPLSTIQQYSKTFFVLPLRGKL antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  24. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328486

    Description: epitope description:SKTFFVLPLRGKLSFWEAGTTKAGY antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  25. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328503

    Description: epitope description:PNAVGGYAISISFWPQTTTTPTSVDMNSIT antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  26. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328509

    Description: epitope description:LYFTSTNGVGEIGRGIALTLFNLADTLLGG antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  27. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328516

    Description: epitope description:LDGRPLSTIQQYSKTFFVLPLRGKLSFWEA antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  28. Identification of an immunodominant ABC transporter in methicillin-resistant Staphylococcus aureus infections.

    ID: 1329034

    Description: epitope description:DVSLRFGDR antigen name:ABC transporter, ATP-binding protein, putative (UniProt:Q2FYP2) host organism:Homo sapiens

    Publication: 10816464;

  29. Identification of an immunodominant ABC transporter in methicillin-resistant Staphylococcus aureus infections.

    ID: 1329040

    Description: epitope description:GDRKLFEDV antigen name:ABC transporter, ATP-binding protein, putative (UniProt:Q2FYP2) host organism:Homo sapiens

    Publication: 10816464;

  30. Identification of an immunodominant ABC transporter in methicillin-resistant Staphylococcus aureus infections.

    ID: 1329043

    Description: epitope description:KLFEDVNIK antigen name:ABC transporter, ATP-binding protein, putative (UniProt:Q2FYP2) host organism:Homo sapiens

    Publication: 10816464;

  31. Identification of an immunodominant ABC transporter in methicillin-resistant Staphylococcus aureus infections.

    ID: 1329051

    Description: epitope description:KFTEGNCYG antigen name:ABC transporter, ATP-binding protein, putative (UniProt:Q2FYP2) host organism:Homo sapiens

    Publication: 10816464;

  32. Identification of an immunodominant ABC transporter in methicillin-resistant Staphylococcus aureus infections.

    ID: 1329053

    Description: epitope description:TEGNCYGLI antigen name:ABC transporter, ATP-binding protein, putative (UniProt:Q2FYP2) host organism:Homo sapiens

    Publication: 10816464;

  33. Identification of an immunodominant ABC transporter in methicillin-resistant Staphylococcus aureus infections.

    ID: 1329055

    Description: epitope description:GNCYGLIGA antigen name:ABC transporter, ATP-binding protein, putative (UniProt:Q2FYP2) host organism:Homo sapiens

    Publication: 10816464;

  34. Identification of an immunodominant ABC transporter in methicillin-resistant Staphylococcus aureus infections.

    ID: 1329065

    Description: epitope description:GAGKSTFLK antigen name:ABC transporter, ATP-binding protein, putative (UniProt:Q2FYP2) host organism:Homo sapiens

    Publication: 10816464;

  35. Identification of an immunodominant ABC transporter in methicillin-resistant Staphylococcus aureus infections.

    ID: 1329074

    Description: epitope description:ILSGELDSQ antigen name:ABC transporter, ATP-binding protein, putative (UniProt:Q2FYP2) host organism:Homo sapiens

    Publication: 10816464;

  36. Identification of an immunodominant ABC transporter in methicillin-resistant Staphylococcus aureus infections.

    ID: 1329085

    Description: epitope description:HVSLGKNER antigen name:ABC transporter, ATP-binding protein, putative (UniProt:Q2FYP2) host organism:Homo sapiens

    Publication: 10816464;

  37. Identification of an immunodominant ABC transporter in methicillin-resistant Staphylococcus aureus infections.

    ID: 1329091

    Description: epitope description:NERLAVLKQ antigen name:ABC transporter, ATP-binding protein, putative (UniProt:Q2FYP2) host organism:Homo sapiens

    Publication: 10816464;

  38. Identification of an immunodominant ABC transporter in methicillin-resistant Staphylococcus aureus infections.

    ID: 1329099

    Description: epitope description:QDHYAYEDE antigen name:ABC transporter, ATP-binding protein, putative (UniProt:Q2FYP2) host organism:Homo sapiens

    Publication: 10816464;

  39. Identification of an immunodominant ABC transporter in methicillin-resistant Staphylococcus aureus infections.

    ID: 1329100

    Description: epitope description:DHYAYEDER antigen name:ABC transporter, ATP-binding protein, putative (UniProt:Q2FYP2) host organism:Homo sapiens

    Publication: 10816464;

  40. Identification of an immunodominant ABC transporter in methicillin-resistant Staphylococcus aureus infections.

    ID: 1329107

    Description: epitope description:ERVLDVVIK antigen name:ABC transporter, ATP-binding protein, putative (UniProt:Q2FYP2) host organism:Homo sapiens

    Publication: 10816464;

  41. Identification of an immunodominant ABC transporter in methicillin-resistant Staphylococcus aureus infections.

    ID: 1329111

    Description: epitope description:DVVIKGHER antigen name:ABC transporter, ATP-binding protein, putative (UniProt:Q2FYP2) host organism:Homo sapiens

    Publication: 10816464;

  42. Identification of an immunodominant ABC transporter in methicillin-resistant Staphylococcus aureus infections.

    ID: 1329129

    Description: epitope description:EIYMKPDFS antigen name:ABC transporter, ATP-binding protein, putative (UniProt:Q2FYP2) host organism:Homo sapiens

    Publication: 10816464;

  43. Identification of an immunodominant ABC transporter in methicillin-resistant Staphylococcus aureus infections.

    ID: 1329130

    Description: epitope description:IYMKPDFSD antigen name:ABC transporter, ATP-binding protein, putative (UniProt:Q2FYP2) host organism:Homo sapiens

    Publication: 10816464;

  44. Identification of an immunodominant ABC transporter in methicillin-resistant Staphylococcus aureus infections.

    ID: 1329138

    Description: epitope description:DEDGIRAAE antigen name:ABC transporter, ATP-binding protein, putative (UniProt:Q2FYP2) host organism:Homo sapiens

    Publication: 10816464;

  45. Identification of an immunodominant ABC transporter in methicillin-resistant Staphylococcus aureus infections.

    ID: 1329143

    Description: epitope description:RAAELEGEF antigen name:ABC transporter, ATP-binding protein, putative (UniProt:Q2FYP2) host organism:Homo sapiens

    Publication: 10816464;

  46. Identification of an immunodominant ABC transporter in methicillin-resistant Staphylococcus aureus infections.

    ID: 1329167

    Description: epitope description:LSGLGIDPT antigen name:ABC transporter, ATP-binding protein, putative (UniProt:Q2FYP2) host organism:Homo sapiens

    Publication: 10816464;

  47. Identification of an immunodominant ABC transporter in methicillin-resistant Staphylococcus aureus infections.

    ID: 1329172

    Description: epitope description:IDPTLHDKK antigen name:ABC transporter, ATP-binding protein, putative (UniProt:Q2FYP2) host organism:Homo sapiens

    Publication: 10816464;

  48. Identification of B- and T-cell epitopes within the fibronectin-binding domain of the SfbI protein of Streptococcus pyogenes.

    ID: 1340549

    Description: epitope description:VETEDTKEPGVLMGGQ antigen name:UniProt:A2RC81 host organism:Mus musculus

    Publication: 14638816;

  49. Identification of B- and T-cell epitopes within the fibronectin-binding domain of the SfbI protein of Streptococcus pyogenes.

    ID: 1340550

    Description: epitope description:DTKEPGVLMGGQSESV antigen name:UniProt:A2RC81 host organism:Mus musculus

    Publication: 14638816;

  50. Identification of B- and T-cell epitopes within the fibronectin-binding domain of the SfbI protein of Streptococcus pyogenes.

    ID: 1340557

    Description: epitope description:QTTPQVETEDTKEPGV antigen name:UniProt:A2RC81 host organism:Mus musculus

    Publication: 14638816;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston