Production of antibodies of predetermined specificity against herpes simplex virus DNA polymerase and their use in characterization of the enzyme.

ID: 1377921

Description: epitope description:MFSGGGGPLSPGGKS antigen name:DNA polymerase catalytic subunit host organism:Mus musculus BALB/c antibody name:mouse sera

Fine mapping of bovine herpesvirus-1 (BHV-1) glycoprotein D (gD) neutralizing epitopes by type-specific monoclonal antibodies and sequence comparison ...

ID: 1377953

Description: epitope description:LGAARGYTFGAC antigen name:envelope glycoprotein D host organism:Mus musculus BALB/c antibody name:MAb R54

Fine mapping of bovine herpesvirus-1 (BHV-1) glycoprotein D (gD) neutralizing epitopes by type-specific monoclonal antibodies and sequence comparison ...

ID: 1377954

Description: epitope description:LGAARGYTFGAC antigen name:envelope glycoprotein D host organism:Oryctolagus cuniculus New Zealand White

Localization of epitopes of herpes simplex virus type 1 glycoprotein D.

ID: 1377964

Description: epitope description:HRRTRKAPKRIRLPHIR antigen name:Envelope glycoprotein D host organism:Mus musculus BALB/c antibody name:57S

Localization of epitopes of herpes simplex virus type 1 glycoprotein D.

ID: 1377971

Description: epitope description:HRRTRKAPKRIRLPHIR antigen name:Envelope glycoprotein D host organism:Oryctolagus cuniculus New Zealand White antibody name:anti-34...

The nature of the immunogen determines the specificity of antibodies and T cells to selected peptides of the 38 kDa mycobacterial antigen.

ID: 1377983

Description: epitope description:MKIRLHTLLAVLTAAPLLLA antigen name:Phosphate-binding protein PstS 1 host organism:Mus musculus C57BL/10

Synthesis and comparison of antibody recognition of conjugates containing herpes simplex virus type 1 glycoprotein D epitope VII.

ID: 1404124

Description: epitope description:LKMADPNRFRG antigen name:Envelope glycoprotein D host organism:Mus musculus antibody name:A16

Monoclonal antibodies to recombinant Der p 2, a major house dust mite allergen: specificity, epitope analysis and development of two-site capture ELIS...

ID: 1404280

Description: epitope description:NQNTKTAKIEIKASIDGLEVDVPGIDPNACHYMKCPLVKGQQYDIKYTWN antigen name:Der p 2 host organism:Mus musculus BALB/c antibody name:3B12, 2B6,...

Monoclonal antibodies to recombinant Der p 2, a major house dust mite allergen: specificity, epitope analysis and development of two-site capture ELIS...

ID: 1404281

Description: epitope description:NQNTKTAKIEIKASIDGLEVDVPGIDPNACHYMKCPLVKGQQYDIKYTWN antigen name:Der p 2 host organism:Mus musculus BALB/c antibody name:3B12, 2B6,...

Recognition of human cytomegalovirus by human primary immunoglobulins identifies an innate foundation to an adaptive immune response.

ID: 1404405

Description: epitope description:ETIYNTTLKY antigen name:Envelope glycoprotein B host organism:Homo sapiens

A mimotope defined by phage display inhibits IgE binding to the plant panallergen profilin.

ID: 1404636

Description: epitope description:CAISGGYPVC host organism:Homo sapiens

Analysis of equine herpesvirus 2 strain variation using monoclonal antibodies to glyucoprotein B.

ID: 1404639

Description: epitope description:VAETTTPFATHRPEVVAEENPANPFLPFRVCGASPTGGEIFRFPLE antigen name:Envelope glycoprotein B (UniProt:Q66613) host organism:Mus musculus BA...

Analysis of equine herpesvirus 2 strain variation using monoclonal antibodies to glyucoprotein B.

ID: 1404652

Description: epitope description:VAETTTPFATHRPEVVAEENPANPFLPFRVCGASPTGGEIFRFPLE antigen name:Envelope glycoprotein B (UniProt:Q66613) host organism:Mus musculus BA...

The allergenic structure of allergen M from cod. I. Tryptic peptides of fragment TM 1.

ID: 1404688

Description: epitope description:EGSFDEDGFYAKVGLDAFSADELK antigen name:Gad m 1 host organism:Homo sapiens antibody name:patient serum

The allergenic structure of allergen M from cod. I. Tryptic peptides of fragment TM 1.

ID: 1404695

Description: epitope description:EGFIEEDELKLFLIAFAADLR antigen name:Gad m 1 host organism:Homo sapiens antibody name:patient serum

The allergenic structure of allergen M from cod. I. Tryptic peptides of fragment TM 1.

ID: 1404698

Description: epitope description:EGSFDEDGFYAKVGLDAFSADELKK antigen name:Gad m 1 host organism:Homo sapiens antibody name:patient serum

Antibodies specific for the antigenic domain 1 of glycoprotein B (gpUL55) of human cytomegalovirus bind to different substructures.

ID: 1404847

Description: epitope description:C573, C610, P570, P577, P613 antigen name:Envelope glycoprotein B host organism:Mus musculus BALB/c antibody name:7-5, 7-17, 9-3, ...

Purification and IgE-binding epitopes of a major allergen in the gastropod Turbo cornutus.

ID: 1405150

Description: epitope description:LAITEVDLERAEARLEAAEAK antigen name:Tropomyosin host organism:Homo sapiens

Enzyme-linked immunosorbent assay of a linear, recombinant peptide designed for immunotherapy of Japanese cedar pollinosis.

ID: 1405195

Description: epitope description:VDGIIAAYQNPASWK antigen name:Cry j 2 host organism:Mus musculus antibody name:E1.237, E1.156, E1.163, G1.67

Enzyme-linked immunosorbent assay of a linear, recombinant peptide designed for immunotherapy of Japanese cedar pollinosis.

ID: 1405196

Description: epitope description:LKMPMYIAGYKTFDG antigen name:Cry j 1 host organism:Mus musculus antibody name:G1.635, G1.432

Purification and IgE-binding epitopes of a major allergen in the gastropod Turbo cornutus.

ID: 1405199

Description: epitope description:SLEISEQEASQREDSYEETIRDLTQRLK antigen name:Tropomyosin host organism:Homo sapiens

Identification of three gp350/220 regions involved in Epstein-Barr virus invasion of host cells.

ID: 1405238

Description: epitope description:QVSLESVDVYFQDVFGTMWC antigen name:Envelope glycoprotein GP350 host organism:Oryctolagus cuniculus New Zealand White antibody name:...

Identification of three gp350/220 regions involved in Epstein-Barr virus invasion of host cells.

ID: 1405244

Description: epitope description:PSTSSKLRPRWTFTSPPVTT antigen name:Envelope glycoprotein GP350 host organism:Oryctolagus cuniculus New Zealand White antibody name:...

Identification of three gp350/220 regions involved in Epstein-Barr virus invasion of host cells.

ID: 1405245

Description: epitope description:QVSLESVDVYFQDVFGTMWC antigen name:Envelope glycoprotein GP350 host organism:Oryctolagus cuniculus New Zealand White antibody name:...

Identification of three gp350/220 regions involved in Epstein-Barr virus invasion of host cells.

ID: 1405251

Description: epitope description:PSTSSKLRPRWTFTSPPVTT antigen name:Envelope glycoprotein GP350 host organism:Oryctolagus cuniculus New Zealand White antibody name:...

Distribution of epitopes within the amino acid sequence of the Epstein-Barr virus major envelope glycoprotein, gp340, recognized by hyperimmune rabbit...

ID: 1408106

Description: epitope description:NPVYLIPET antigen name:Envelope glycoprotein GP350 host organism:Oryctolagus cuniculus New Zealand White antibody name:rabbit anti...

Molecular cloning, recombinant expression and IgE-binding epitope of omega-5 gliadin, a major allergen in wheat-dependent exercise-induced anaphylaxis...

ID: 1408204

Description: epitope description:QQSPEQQ antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

Molecular cloning, recombinant expression and IgE-binding epitope of omega-5 gliadin, a major allergen in wheat-dependent exercise-induced anaphylaxis...

ID: 1408209

Description: epitope description:QQPPQQ antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

Molecular cloning, recombinant expression and IgE-binding epitope of omega-5 gliadin, a major allergen in wheat-dependent exercise-induced anaphylaxis...

ID: 1408210

Description: epitope description:QQFHQQQ antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

Humoral and cellular immune responses to synthetic peptides of the Leishmania donovani kinetoplastid membrane protein-11.

ID: 1408569

Description: epitope description:MATTYEEFSAKLDRLDEEFNRKMQEQNAKFFADKPDES antigen name:Kinetoplastid membrane protein-11 host organism:Homo sapiens antibody name:Hum...

Development of an equine herpesvirus type 4-specific enzyme-linked immunosorbent assay using a B-cell epitope as an antigen.

ID: 1408789

Description: epitope description:EGSLMLNVQHDD antigen name:70 host organism:Equus caballus

Distribution of epitopes within the amino acid sequence of the Epstein-Barr virus major envelope glycoprotein, gp340, recognized by hyperimmune rabbit...

ID: 1408922

Description: epitope description:MEAALLVCQYTIQSL antigen name:Envelope glycoprotein GP350 host organism:Oryctolagus cuniculus New Zealand White antibody name:rabbi...

Distribution of epitopes within the amino acid sequence of the Epstein-Barr virus major envelope glycoprotein, gp340, recognized by hyperimmune rabbit...

ID: 1408931

Description: epitope description:YTIQSLIHLTGEDPG antigen name:Envelope glycoprotein GP350 host organism:Oryctolagus cuniculus New Zealand White antibody name:rabbi...

Distribution of epitopes within the amino acid sequence of the Epstein-Barr virus major envelope glycoprotein, gp340, recognized by hyperimmune rabbit...

ID: 1408940

Description: epitope description:GGKKHQLDLDFGQLT antigen name:Envelope glycoprotein GP350 host organism:Oryctolagus cuniculus New Zealand White antibody name:rabbi...

Distribution of epitopes within the amino acid sequence of the Epstein-Barr virus major envelope glycoprotein, gp340, recognized by hyperimmune rabbit...

ID: 1408943

Description: epitope description:KHQLDLDFGQLTPHT antigen name:Envelope glycoprotein GP350 host organism:Oryctolagus cuniculus New Zealand White antibody name:rabbi...

Distribution of epitopes within the amino acid sequence of the Epstein-Barr virus major envelope glycoprotein, gp340, recognized by hyperimmune rabbit...

ID: 1408945

Description: epitope description:KHQLDLDFGQLTPHT antigen name:Envelope glycoprotein GP350 host organism:Oryctolagus cuniculus New Zealand White antibody name:rabbi...

Distribution of epitopes within the amino acid sequence of the Epstein-Barr virus major envelope glycoprotein, gp340, recognized by hyperimmune rabbit...

ID: 1408947

Description: epitope description:LDLDFGQLTPHTKAV antigen name:Envelope glycoprotein GP350 host organism:Oryctolagus cuniculus New Zealand White antibody name:rabbi...

Distribution of epitopes within the amino acid sequence of the Epstein-Barr virus major envelope glycoprotein, gp340, recognized by hyperimmune rabbit...

ID: 1408948

Description: epitope description:LDLDFGQLTPHTKAV antigen name:Envelope glycoprotein GP350 host organism:Oryctolagus cuniculus New Zealand White antibody name:rabbi...

Distribution of epitopes within the amino acid sequence of the Epstein-Barr virus major envelope glycoprotein, gp340, recognized by hyperimmune rabbit...

ID: 1408955

Description: epitope description:PHTKAVYQPRGAFGG antigen name:Envelope glycoprotein GP350 host organism:Oryctolagus cuniculus New Zealand White antibody name:rabbi...

Distribution of epitopes within the amino acid sequence of the Epstein-Barr virus major envelope glycoprotein, gp340, recognized by hyperimmune rabbit...

ID: 1408961

Description: epitope description:YQPRGAFGGSENATN antigen name:Envelope glycoprotein GP350 host organism:Oryctolagus cuniculus New Zealand White antibody name:rabbi...

Distribution of epitopes within the amino acid sequence of the Epstein-Barr virus major envelope glycoprotein, gp340, recognized by hyperimmune rabbit...

ID: 1408962

Description: epitope description:YQPRGAFGGSENATN antigen name:Envelope glycoprotein GP350 host organism:Oryctolagus cuniculus New Zealand White antibody name:rabbi...

Distribution of epitopes within the amino acid sequence of the Epstein-Barr virus major envelope glycoprotein, gp340, recognized by hyperimmune rabbit...

ID: 1408965

Description: epitope description:RGAFGGSENATNLFL antigen name:Envelope glycoprotein GP350 host organism:Oryctolagus cuniculus New Zealand White antibody name:rabbi...

Distribution of epitopes within the amino acid sequence of the Epstein-Barr virus major envelope glycoprotein, gp340, recognized by hyperimmune rabbit...

ID: 1408971

Description: epitope description:PETVPYIKWDNCNST antigen name:Envelope glycoprotein GP350 host organism:Oryctolagus cuniculus New Zealand White antibody name:rabbi...

Distribution of epitopes within the amino acid sequence of the Epstein-Barr virus major envelope glycoprotein, gp340, recognized by hyperimmune rabbit...

ID: 1408972

Description: epitope description:PETVPYIKWDNCNST antigen name:Envelope glycoprotein GP350 host organism:Oryctolagus cuniculus New Zealand White antibody name:rabbi...

Distribution of epitopes within the amino acid sequence of the Epstein-Barr virus major envelope glycoprotein, gp340, recognized by hyperimmune rabbit...

ID: 1408983

Description: epitope description:NSTNITAVVRAQGLD antigen name:Envelope glycoprotein GP350 host organism:Oryctolagus cuniculus New Zealand White antibody name:rabbi...

Distribution of epitopes within the amino acid sequence of the Epstein-Barr virus major envelope glycoprotein, gp340, recognized by hyperimmune rabbit...

ID: 1408986

Description: epitope description:NITAVVRAQGLDVTL antigen name:Envelope glycoprotein GP350 host organism:Oryctolagus cuniculus New Zealand White antibody name:rabbi...

Distribution of epitopes within the amino acid sequence of the Epstein-Barr virus major envelope glycoprotein, gp340, recognized by hyperimmune rabbit...

ID: 1408992

Description: epitope description:RAQGLDVTLPLSLPT antigen name:Envelope glycoprotein GP350 host organism:Oryctolagus cuniculus New Zealand White antibody name:rabbi...

Distribution of epitopes within the amino acid sequence of the Epstein-Barr virus major envelope glycoprotein, gp340, recognized by hyperimmune rabbit...

ID: 1408994

Description: epitope description:GLDVTLPLSLPTSAQ antigen name:Envelope glycoprotein GP350 host organism:Oryctolagus cuniculus New Zealand White antibody name:rabbi...

Distribution of epitopes within the amino acid sequence of the Epstein-Barr virus major envelope glycoprotein, gp340, recognized by hyperimmune rabbit...

ID: 1409003

Description: epitope description:LPTSAQDSNFSVKTE antigen name:Envelope glycoprotein GP350 host organism:Oryctolagus cuniculus New Zealand White antibody name:rabbi...

Distribution of epitopes within the amino acid sequence of the Epstein-Barr virus major envelope glycoprotein, gp340, recognized by hyperimmune rabbit...

ID: 1409008

Description: epitope description:SAQDSNFSVKTEMLG antigen name:Envelope glycoprotein GP350 host organism:Oryctolagus cuniculus New Zealand White antibody name:rabbi...

Distribution of epitopes within the amino acid sequence of the Epstein-Barr virus major envelope glycoprotein, gp340, recognized by hyperimmune rabbit...

ID: 1409009

Description: epitope description:DSNFSVKTEMLGNEI antigen name:Envelope glycoprotein GP350 host organism:Oryctolagus cuniculus New Zealand White antibody name:rabbi...

Distribution of epitopes within the amino acid sequence of the Epstein-Barr virus major envelope glycoprotein, gp340, recognized by hyperimmune rabbit...

ID: 1409035

Description: epitope description:PLSLPTSAQDSNFSV antigen name:Envelope glycoprotein GP350 host organism:Oryctolagus cuniculus New Zealand White antibody name:rabbi...

Distribution of epitopes within the amino acid sequence of the Epstein-Barr virus major envelope glycoprotein, gp340, recognized by hyperimmune rabbit...

ID: 1409036

Description: epitope description:LPTSAQDSNFSVKTE antigen name:Envelope glycoprotein GP350 host organism:Oryctolagus cuniculus New Zealand White antibody name:rabbi...

Distribution of epitopes within the amino acid sequence of the Epstein-Barr virus major envelope glycoprotein, gp340, recognized by hyperimmune rabbit...

ID: 1409037

Description: epitope description:SAQDSNFSVKTEMLG antigen name:Envelope glycoprotein GP350 host organism:Oryctolagus cuniculus New Zealand White antibody name:rabbi...

Distribution of epitopes within the amino acid sequence of the Epstein-Barr virus major envelope glycoprotein, gp340, recognized by hyperimmune rabbit...

ID: 1409039

Description: epitope description:FSVKTEMLGNEIDIE antigen name:Envelope glycoprotein GP350 host organism:Oryctolagus cuniculus New Zealand White antibody name:rabbi...

Specificity of antibodies reactive with hepatitis B surface antigen following immunization with synthetic peptides.

ID: 1409091

Description: epitope description:GFLGPLL antigen name:Large envelope protein host organism:Oryctolagus cuniculus

Specificity of antibodies reactive with hepatitis B surface antigen following immunization with synthetic peptides.

ID: 1409104

Description: epitope description:FLLTRIL antigen name:Large envelope protein host organism:Oryctolagus cuniculus

Specificity of antibodies reactive with hepatitis B surface antigen following immunization with synthetic peptides.

ID: 1409111

Description: epitope description:TIPQSLD antigen name:Large envelope protein host organism:Oryctolagus cuniculus

Specificity of antibodies reactive with hepatitis B surface antigen following immunization with synthetic peptides.

ID: 1409113

Description: epitope description:PQSLDSW antigen name:Large envelope protein host organism:Oryctolagus cuniculus

Specificity of antibodies reactive with hepatitis B surface antigen following immunization with synthetic peptides.

ID: 1409114

Description: epitope description:QSLDSWW antigen name:Large envelope protein host organism:Oryctolagus cuniculus

Specificity of antibodies reactive with hepatitis B surface antigen following immunization with synthetic peptides.

ID: 1409123

Description: epitope description:LNFLGGS antigen name:Large envelope protein host organism:Oryctolagus cuniculus

Specificity of antibodies reactive with hepatitis B surface antigen following immunization with synthetic peptides.

ID: 1409124

Description: epitope description:NFLGGSP antigen name:Large envelope protein host organism:Oryctolagus cuniculus

Specificity of antibodies reactive with hepatitis B surface antigen following immunization with synthetic peptides.

ID: 1409131

Description: epitope description:VCLGQNS antigen name:Large envelope protein host organism:Oryctolagus cuniculus

Specificity of antibodies reactive with hepatitis B surface antigen following immunization with synthetic peptides.

ID: 1409140

Description: epitope description:PTSNHSP antigen name:Large envelope protein host organism:Oryctolagus cuniculus

Specificity of antibodies reactive with hepatitis B surface antigen following immunization with synthetic peptides.

ID: 1409142

Description: epitope description:SNHSPTS antigen name:Large envelope protein host organism:Oryctolagus cuniculus

Specificity of antibodies reactive with hepatitis B surface antigen following immunization with synthetic peptides.

ID: 1409143

Description: epitope description:NHSPTSC antigen name:Large envelope protein host organism:Oryctolagus cuniculus

Specificity of antibodies reactive with hepatitis B surface antigen following immunization with synthetic peptides.

ID: 1409144

Description: epitope description:HSPTSCP antigen name:Large envelope protein host organism:Oryctolagus cuniculus

Specificity of antibodies reactive with hepatitis B surface antigen following immunization with synthetic peptides.

ID: 1409147

Description: epitope description:TSCPPIC antigen name:Large envelope protein host organism:Oryctolagus cuniculus

Specificity of antibodies reactive with hepatitis B surface antigen following immunization with synthetic peptides.

ID: 1409157

Description: epitope description:RWMCLRR antigen name:Large envelope protein host organism:Oryctolagus cuniculus

Specificity of antibodies reactive with hepatitis B surface antigen following immunization with synthetic peptides.

ID: 1409191

Description: epitope description:VCPLIPG antigen name:Large envelope protein host organism:Oryctolagus cuniculus

Specificity of antibodies reactive with hepatitis B surface antigen following immunization with synthetic peptides.

ID: 1409195

Description: epitope description:IPGSTTT antigen name:Large envelope protein host organism:Oryctolagus cuniculus

Structure, antigenic determinants of some clinically important insect allergens: chironomid hemoglobins.

ID: 1410218

Description: epitope description:IVSFLSEVISLAGSDANIPAIQNLAK antigen name:Globin CTT-VI host organism:Homo sapiens antibody name:patient sera

Structure, antigenic determinants of some clinically important insect allergens: chironomid hemoglobins.

ID: 1410220

Description: epitope description:AHINFDGPTETAWTLALDTTYAMLFSAMDS antigen name:Globin CTT-VI host organism:Homo sapiens antibody name:patient sera

Molecular evolution of antibody cross-reactivity for two subtypes of type A botulinum neurotoxin.

ID: 1410242

Description: epitope description:F953, R1064 antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus antibody name:AR2

Structure, antigenic determinants of some clinically important insect allergens: chironomid hemoglobins.

ID: 1410257

Description: epitope description:IVSFLSEVISLAGSDANIPAIQNLAK antigen name:Globin CTT-VI host organism:Homo sapiens antibody name:patient sera

Structure, antigenic determinants of some clinically important insect allergens: chironomid hemoglobins.

ID: 1410260

Description: epitope description:KAYPDIMAKFPQFAGKDLDSIKDSAAF antigen name:Globin CTT-VI host organism:Homo sapiens antibody name:patient sera

Crystal structure of glycoprotein B from herpes simplex virus 1.

ID: 1410449

Description: epitope description:R304 antigen name:Envelope glycoprotein B host organism:Mus musculus BALB/c antibody name:H1375

Crystal structure of glycoprotein B from herpes simplex virus 1.

ID: 1410450

Description: epitope description:E305 antigen name:Envelope glycoprotein B host organism:Mus musculus BALB/c antibody name:B4

The C terminus of component C2II of Clostridium botulinum C2 toxin is essential for receptor binding.

ID: 1410460

Description: epitope description:ANANRDTDRDGIPDE antigen name:Other Clostridium botulinum protein host organism:Oryctolagus cuniculus

The C terminus of component C2II of Clostridium botulinum C2 toxin is essential for receptor binding.

ID: 1410461

Description: epitope description:RLSGVFLIELDKLII antigen name:Other Clostridium botulinum protein host organism:Oryctolagus cuniculus

The C terminus of component C2II of Clostridium botulinum C2 toxin is essential for receptor binding.

ID: 1410464

Description: epitope description:FKENISSINIINDTNFGVQSMTGLSNRSKGQDGIYRAATTAFSFKSKELKYPEGRYRMRFVIQSYEPFTCNFKLFNNLIYSSSFDKGYYDEFFYFYYNGSKSFFNISCDIINSINRLSGVFLIELDKLII...

The C terminus of component C2II of Clostridium botulinum C2 toxin is essential for receptor binding.

ID: 1410481

Description: epitope description:MLVSKFENSVKNSNKNYFTINGLMGYYFENDFFNLNIISPTLDGNLTFSKEDINSILGNKIIKSARWIGLIKPSITGEYILSTNSPNCRVELNGEIFNLSLNTSNTVNLIQGNVYDIRIEQLMSENQLLK...

The C terminus of component C2II of Clostridium botulinum C2 toxin is essential for receptor binding.

ID: 1410483

Description: epitope description:MLVSKFENSVKNSNKNYFTINGLMGYYFENDFFNLNIISPTLDGNLTFSKEDINSILGNKIIKSARWIGLIKPSITGEYILSTNSPNCRVELNGEIFNLSLNTSNTVNLIQGNVYDIRIEQLMSENQLLK...

Characterization of murine monoclonal and murine, rabbit, and human polyclonal antibodies against chlamydial lipopolysaccharide.

ID: 1410594

Description: epitope description:alpha-Kdo-(2->4)-alpha-Kdo antigen name:lipopolysaccharide host organism:Oryctolagus cuniculus

Treatment of cat allergy with T-cell reactive peptides.

ID: 1410604

Description: epitope description:KRDVDLFLTGTPDEYVEQVAQYKALPV antigen name:Fel d 1 host organism:Homo sapiens

Characterization of murine monoclonal and murine, rabbit, and human polyclonal antibodies against chlamydial lipopolysaccharide.

ID: 1410605

Description: epitope description:3-deoxy-alpha-D-manno-oct-2-ulopyranosonic acid antigen name:lipopolysaccharide host organism:Mus musculus BALB/c

Structural and functional complexity of the humoral response against the Trypanosoma cruzi ribosomal P2 beta protein in patients with chronic Chagas' ...

ID: 1410811

Description: epitope description:EESDDDMGFGLFD antigen name:60S acidic ribosomal protein P2 host organism:Homo sapiens

Structural and functional complexity of the humoral response against the Trypanosoma cruzi ribosomal P2 beta protein in patients with chronic Chagas' ...

ID: 1410812

Description: epitope description:EEEDDDMGFGLFD antigen name:Other Trypanosoma cruzi protein host organism:Homo sapiens

Treatment of cat allergy with T-cell reactive peptides.

ID: 1410814

Description: epitope description:KALPVVLENARILKNCVDAKMTEEDKE antigen name:Fel d 1 host organism:Homo sapiens

Mapping of conformational IgE epitopes on Phl p 5a by using mimotopes from a phage display library.

ID: 1411228

Description: epitope description:SRLGRSSAWV host organism:Homo sapiens antibody name:anti-Phl p 5

Mapping of conformational IgE epitopes on Phl p 5a by using mimotopes from a phage display library.

ID: 1411243

Description: epitope description:ERAGAMERAN host organism:Homo sapiens antibody name:anti-Phl p 5

Mapping of conformational IgE epitopes on Phl p 5a by using mimotopes from a phage display library.

ID: 1411244

Description: epitope description:RSVSKEEPGM host organism:Homo sapiens antibody name:anti-Phl p 5

Mapping of conformational IgE epitopes on Phl p 5a by using mimotopes from a phage display library.

ID: 1411251

Description: epitope description:PSTPGSRQNM host organism:Homo sapiens antibody name:Phl p 5a-specific IgE

Mapping of conformational IgE epitopes on Phl p 5a by using mimotopes from a phage display library.

ID: 1411260

Description: epitope description:VQDLMKSSGV host organism:Homo sapiens antibody name:Phl p 5a-specific IgE

A major wheat allergen has a Gln-Gln-Gln-Pro-Pro motif identified as an IgE-binding epitope.

ID: 1411265

Description: epitope description:QQQPP antigen name:Uncharacterized protein (UniProt:Q8W3V4) host organism:Homo sapiens

A major wheat allergen has a Gln-Gln-Gln-Pro-Pro motif identified as an IgE-binding epitope.

ID: 1411267

Description: epitope description:QQQPP antigen name:Uncharacterized protein (UniProt:Q8W3V4) host organism:Homo sapiens

Identification and fine mapping of IgG and IgE epitopes in ovomucoid.

ID: 1411428

Description: epitope description:SSYAN antigen name:Gal d 1 host organism:Homo sapiens antibody name:patient sera

Epitope characterization of ovalbumin in BALB/c mice using different entry routes.

ID: 1411660

Description: epitope description:GSIGAASMEFCF antigen name:Gal d 2 host organism:Mus musculus BALB/c

Identification of tropomyosin as the major shrimp allergen and characterization of its IgE-binding epitopes.

ID: 1411661

Description: epitope description:MQQLENDLDQVQESLLK antigen name:Fenneropenaeus indicus protein host organism:Homo sapiens

Identification of tropomyosin as the major shrimp allergen and characterization of its IgE-binding epitopes.

ID: 1411662

Description: epitope description:MQQLENDLDQVQESLLK antigen name:Fenneropenaeus indicus protein host organism:Homo sapiens