Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. IgE and IgG binding of peptides expressed from fragments of cDNA encoding the major house dust mite allergen Der p I.

    ID: 1472118

    Description: epitope description:LAHRNQSLDLAEQELVDCASQHGCH antigen name:Der p 1 host organism:Homo sapiens antibody name:patient sera

    Publication: 1940366;

  2. IgE and IgG binding of peptides expressed from fragments of cDNA encoding the major house dust mite allergen Der p I.

    ID: 1472124

    Description: epitope description:AREQSCRRPNAQRFGISNYCQIYPPNANKIREALAQPQRYCRH antigen name:Der p 1 host organism:Homo sapiens antibody name:patient sera

    Publication: 1940366;

  3. IgE and IgG binding of peptides expressed from fragments of cDNA encoding the major house dust mite allergen Der p I.

    ID: 1472130

    Description: epitope description:DLMMIEEYPYVVIL antigen name:Der p 1 host organism:Homo sapiens antibody name:patient sera

    Publication: 1940366;

  4. IgE and IgG binding of peptides expressed from fragments of cDNA encoding the major house dust mite allergen Der p I.

    ID: 1472133

    Description: epitope description:LAHRNQSLDLAEQELVDCASQHGCH antigen name:Der p 1 host organism:Oryctolagus cuniculus antibody name:hyperimmune rabbit anti-Der p I s...

    Publication: 1940366;

  5. Multi-epitope schistosome vaccine candidates tested for protective immunogenicity in mice.

    ID: 1472146

    Description: epitope description:EVCVRQLKAIANK antigen name:Triosephosphate isomerase host organism:Oryctolagus cuniculus antibody name:rabbit serum

    Publication: 10924792;

  6. Multi-epitope schistosome vaccine candidates tested for protective immunogenicity in mice.

    ID: 1472147

    Description: epitope description:EVCVRQLKAIANK antigen name:Triosephosphate isomerase host organism:Oryctolagus cuniculus antibody name:rabbit serum

    Publication: 10924792;

  7. Multi-epitope schistosome vaccine candidates tested for protective immunogenicity in mice.

    ID: 1472148

    Description: epitope description:KWFKTNAPNGVDEKIRI antigen name:Triosephosphate isomerase host organism:Mus musculus CBA antibody name:mouse serum

    Publication: 10924792;

  8. Multi-epitope schistosome vaccine candidates tested for protective immunogenicity in mice.

    ID: 1472159

    Description: epitope description:SSFHCCGAKGPDDYRGNVPASCK antigen name:Tetraspanin host organism:Mus musculus CBA antibody name:mouse serum

    Publication: 10924792;

  9. Multi-epitope schistosome vaccine candidates tested for protective immunogenicity in mice.

    ID: 1472165

    Description: epitope description:YFDGRGRAESIRMTLVAAGVDYEDERISFQDWPK antigen name:Glutathione S-transferase class-mu 28 kDa isozyme host organism:Oryctolagus cunicu...

    Publication: 10924792;

  10. Multi-epitope schistosome vaccine candidates tested for protective immunogenicity in mice.

    ID: 1472166

    Description: epitope description:KPQEEKEKITKEILNGK antigen name:Glutathione S-transferase class-mu 28 kDa isozyme host organism:Mus musculus CBA antibody name:mous...

    Publication: 10924792;

  11. Multi-epitope schistosome vaccine candidates tested for protective immunogenicity in mice.

    ID: 1472167

    Description: epitope description:KPQEEKEKITKEILNGK antigen name:Glutathione S-transferase class-mu 28 kDa isozyme host organism:Mus musculus CBA antibody name:mous...

    Publication: 10924792;

  12. Multi-epitope schistosome vaccine candidates tested for protective immunogenicity in mice.

    ID: 1472169

    Description: epitope description:KPQEEKEKITKEILNGK antigen name:Glutathione S-transferase class-mu 28 kDa isozyme host organism:Oryctolagus cuniculus antibody name...

    Publication: 10924792;

  13. Multi-epitope schistosome vaccine candidates tested for protective immunogenicity in mice.

    ID: 1472170

    Description: epitope description:ENLLASSPRLAKYLSNRPATPF antigen name:Glutathione S-transferase class-mu 28 kDa isozyme host organism:Mus musculus CBA antibody name...

    Publication: 10924792;

  14. Multi-epitope schistosome vaccine candidates tested for protective immunogenicity in mice.

    ID: 1472204

    Description: epitope description:KWFKTNAPNGVDEKIRI antigen name:Triosephosphate isomerase host organism:Mus musculus BALB/c antibody name:mouse serum

    Publication: 10924792;

  15. Multi-epitope schistosome vaccine candidates tested for protective immunogenicity in mice.

    ID: 1472209

    Description: epitope description:YFDGRGRAESIRMTLVAAGVDYEDERISFQDWPK antigen name:Glutathione S-transferase class-mu 28 kDa isozyme host organism:Mus musculus BALB/...

    Publication: 10924792;

  16. Multi-epitope schistosome vaccine candidates tested for protective immunogenicity in mice.

    ID: 1472214

    Description: epitope description:MMNHDTESHVKISRTIYRGVSPSTT antigen name:Putative paramyosin host organism:Mus musculus BALB/c antibody name:mouse serum

    Publication: 10924792;

  17. Recognition of B and T cell epitopes by cattle immunized with a synthetic peptide containing the major immunogenic site of VP1 FMDV 01 Campos.

    ID: 1472229

    Description: epitope description:RYSRNAVPNV antigen name:Polyprotein host organism:Bos taurus antibody name:Cattle immunoglobulin

    Publication: 8184548;

  18. Recognition of B and T cell epitopes by cattle immunized with a synthetic peptide containing the major immunogenic site of VP1 FMDV 01 Campos.

    ID: 1472236

    Description: epitope description:RYSRNAVPNV antigen name:Polyprotein host organism:Bos taurus antibody name:Cattle immunoglobulin

    Publication: 8184548;

  19. Recognition of B and T cell epitopes by cattle immunized with a synthetic peptide containing the major immunogenic site of VP1 FMDV 01 Campos.

    ID: 1472244

    Description: epitope description:AVPNVRGDLQ antigen name:Polyprotein host organism:Bos taurus antibody name:Cattle immunoglobulin

    Publication: 8184548;

  20. Recognition of B and T cell epitopes by cattle immunized with a synthetic peptide containing the major immunogenic site of VP1 FMDV 01 Campos.

    ID: 1472246

    Description: epitope description:AVPNVRGDLQ antigen name:Polyprotein host organism:Bos taurus antibody name:Cattle immunoglobulin

    Publication: 8184548;

  21. Recognition of B and T cell epitopes by cattle immunized with a synthetic peptide containing the major immunogenic site of VP1 FMDV 01 Campos.

    ID: 1472255

    Description: epitope description:RGDLQVLAQK antigen name:Polyprotein host organism:Bos taurus antibody name:Cattle immunoglobulin

    Publication: 8184548;

  22. Recognition of B and T cell epitopes by cattle immunized with a synthetic peptide containing the major immunogenic site of VP1 FMDV 01 Campos.

    ID: 1472256

    Description: epitope description:RGDLQVLAQK antigen name:Polyprotein host organism:Bos taurus antibody name:Cattle immunoglobulin

    Publication: 8184548;

  23. Recognition of B and T cell epitopes by cattle immunized with a synthetic peptide containing the major immunogenic site of VP1 FMDV 01 Campos.

    ID: 1472259

    Description: epitope description:RGDLQVLAQK antigen name:Polyprotein host organism:Bos taurus antibody name:Cattle immunoglobulin

    Publication: 8184548;

  24. Recognition of B and T cell epitopes by cattle immunized with a synthetic peptide containing the major immunogenic site of VP1 FMDV 01 Campos.

    ID: 1472271

    Description: epitope description:VLAQKVARTLP antigen name:Polyprotein host organism:Bos taurus antibody name:Cattle immunoglobulin

    Publication: 8184548;

  25. Recognition of B and T cell epitopes by cattle immunized with a synthetic peptide containing the major immunogenic site of VP1 FMDV 01 Campos.

    ID: 1472274

    Description: epitope description:VLAQKVARTLP antigen name:Polyprotein host organism:Bos taurus antibody name:Cattle immunoglobulin

    Publication: 8184548;

  26. Mimotopes identify conformational epitopes on parvalbumin, the major fish allergen.

    ID: 1472283

    Description: epitope description:CFRGLDVAGNVC host organism:Homo sapiens antibody name:affinity-purified anti-parvalbumin patient sera

    Publication: 16150491;

  27. Recognition of B and T cell epitopes by cattle immunized with a synthetic peptide containing the major immunogenic site of VP1 FMDV 01 Campos.

    ID: 1472292

    Description: epitope description:RYSRNAVPNVRGDLQVLAQKVARTLP antigen name:Polyprotein host organism:Bos taurus antibody name:Cattle immunoglobulin

    Publication: 8184548;

  28. Recognition of B and T cell epitopes by cattle immunized with a synthetic peptide containing the major immunogenic site of VP1 FMDV 01 Campos.

    ID: 1472293

    Description: epitope description:RYSRNAVPNVRGDLQVLAQKVARTLP antigen name:Polyprotein host organism:Bos taurus antibody name:Cattle immunoglobulin

    Publication: 8184548;

  29. Protective and nonprotective epitopes of chemically synthesized peptides of the NH2-terminal region of type 6 streptococcal M protein.

    ID: 1466689

    Description: epitope description:RVFPRGTVENPDKARELLNK antigen name:UniProt:A2RGM0 host organism:Oryctolagus cuniculus New Zealand White antibody name:Anti-S-M6(12-...

    Publication: 2419429;

  30. Protective and nonprotective epitopes of chemically synthesized peptides of the NH2-terminal region of type 6 streptococcal M protein.

    ID: 1466698

    Description: epitope description:NPDKARELLNK antigen name:UniProt:A2RGM0 host organism:Oryctolagus cuniculus New Zealand White antibody name:Anti-S-M6(10-20)

    Publication: 2419429;

  31. Protective and nonprotective epitopes of chemically synthesized peptides of the NH2-terminal region of type 6 streptococcal M protein.

    ID: 1466703

    Description: epitope description:NPDKARELLNK antigen name:UniProt:A2RGM0 host organism:Oryctolagus cuniculus New Zealand White antibody name:Anti-S-M6(1-20)

    Publication: 2419429;

  32. Protective and nonprotective epitopes of chemically synthesized peptides of the NH2-terminal region of type 6 streptococcal M protein.

    ID: 1466708

    Description: epitope description:NPDKARELLNK antigen name:UniProt:A2RGM0 host organism:Oryctolagus cuniculus New Zealand White antibody name:Anti-S-M6(10-20)

    Publication: 2419429;

  33. Protective and nonprotective epitopes of chemically synthesized peptides of the NH2-terminal region of type 6 streptococcal M protein.

    ID: 1466710

    Description: epitope description:NPDKARELLNK antigen name:UniProt:A2RGM0 host organism:Oryctolagus cuniculus New Zealand White antibody name:Anti-S-M6(10-20)

    Publication: 2419429;

  34. Protective and nonprotective epitopes of chemically synthesized peptides of the NH2-terminal region of type 6 streptococcal M protein.

    ID: 1466738

    Description: epitope description:DKARELLNKYDVENSMLQAN antigen name:UniProt:A2RGM0 host organism:Oryctolagus cuniculus New Zealand White antibody name:Anti-S-M6(22-...

    Publication: 2419429;

  35. Protective and nonprotective epitopes of chemically synthesized peptides of the NH2-terminal region of type 6 streptococcal M protein.

    ID: 1466747

    Description: epitope description:DKARELLNKYDVENSMLQAN antigen name:UniProt:A2RGM0 host organism:Oryctolagus cuniculus New Zealand White antibody name:Rabbit antise...

    Publication: 2419429;

  36. Protective and nonprotective epitopes of chemically synthesized peptides of the NH2-terminal region of type 6 streptococcal M protein.

    ID: 1466750

    Description: epitope description:DKARELLNKYDVENSMLQAN antigen name:UniProt:A2RGM0 host organism:Oryctolagus cuniculus New Zealand White antibody name:Anti-S-M6(12-...

    Publication: 2419429;

  37. Novel B and T cell epitopes of chicken ovomucoid (Gal d 1) induce T cell secretion of IL-6, IL-13, and IFN-gamma.

    ID: 1466840

    Description: epitope description:TYDNECLLCAHKVE antigen name:Gal d 1 host organism:Homo sapiens antibody name:patient sera

    Publication: 11422162;

  38. Novel B and T cell epitopes of chicken ovomucoid (Gal d 1) induce T cell secretion of IL-6, IL-13, and IFN-gamma.

    ID: 1466882

    Description: epitope description:RPLCGSDNKTYGNK antigen name:Gal d 1 host organism:Homo sapiens antibody name:patient sera

    Publication: 11422162;

  39. Novel B and T cell epitopes of chicken ovomucoid (Gal d 1) induce T cell secretion of IL-6, IL-13, and IFN-gamma.

    ID: 1466908

    Description: epitope description:ECKETVPMNCSSYA antigen name:Gal d 1 host organism:Oryctolagus cuniculus antibody name:anti-ovomucoid

    Publication: 11422162;

  40. Protective and nonprotective epitopes of chemically synthesized peptides of the NH2-terminal region of type 6 streptococcal M protein.

    ID: 1466916

    Description: epitope description:DVENSMLQAN antigen name:UniProt:A2RGM0 host organism:Oryctolagus cuniculus New Zealand White antibody name:Rabbit antisera to type...

    Publication: 2419429;

  41. Protective and nonprotective epitopes of chemically synthesized peptides of the NH2-terminal region of type 6 streptococcal M protein.

    ID: 1466925

    Description: epitope description:DVENSMLQAN antigen name:UniProt:A2RGM0 host organism:Oryctolagus cuniculus New Zealand White antibody name:Anti-S-M6(1-20)

    Publication: 2419429;

  42. Novel B and T cell epitopes of chicken ovomucoid (Gal d 1) induce T cell secretion of IL-6, IL-13, and IFN-gamma.

    ID: 1466929

    Description: epitope description:TYDNECLLCAHKVE antigen name:Gal d 1 host organism:Oryctolagus cuniculus antibody name:anti-ovomucoid

    Publication: 11422162;

  43. Novel B and T cell epitopes of chicken ovomucoid (Gal d 1) induce T cell secretion of IL-6, IL-13, and IFN-gamma.

    ID: 1466930

    Description: epitope description:HKVEQGASVDKRHD antigen name:Gal d 1 host organism:Oryctolagus cuniculus antibody name:anti-ovomucoid

    Publication: 11422162;

  44. Novel B and T cell epitopes of chicken ovomucoid (Gal d 1) induce T cell secretion of IL-6, IL-13, and IFN-gamma.

    ID: 1466934

    Description: epitope description:GKVMVLCNRAFNPV antigen name:Gal d 1 host organism:Oryctolagus cuniculus antibody name:anti-ovomucoid

    Publication: 11422162;

  45. Novel B and T cell epitopes of chicken ovomucoid (Gal d 1) induce T cell secretion of IL-6, IL-13, and IFN-gamma.

    ID: 1466937

    Description: epitope description:LAAVSVDCSEYPKP antigen name:Gal d 1 host organism:Oryctolagus cuniculus antibody name:anti-ovomucoid

    Publication: 11422162;

  46. C-terminal region of human T cell lymphotropic virus type I (HTLVI) p19 core protein is immunogenic in humans and contains an HTLVI-specific epitope.

    ID: 1466944

    Description: epitope description:PPSSPTHDPPDSDP antigen name:Gag-Pro-Pol polyprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2419433;

  47. C-terminal region of human T cell lymphotropic virus type I (HTLVI) p19 core protein is immunogenic in humans and contains an HTLVI-specific epitope.

    ID: 1466945

    Description: epitope description:PYVEPTAPQVL antigen name:Gag-Pro-Pol polyprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2419433;

  48. C-terminal region of human T cell lymphotropic virus type I (HTLVI) p19 core protein is immunogenic in humans and contains an HTLVI-specific epitope.

    ID: 1466946

    Description: epitope description:PYVEPTAPQVL antigen name:Gag-Pro-Pol polyprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2419433;

  49. Assessment of protective immune responses against hydatid disease in sheep by immunization with synthetic peptide antigens.

    ID: 1466958

    Description: epitope description:SLKAVNPSDPLVYKRQTAKF antigen name:Antigen protein host organism:Ovis aries Merino X Border Leiscester

    Publication: 11085234;

  50. Assessment of protective immune responses against hydatid disease in sheep by immunization with synthetic peptide antigens.

    ID: 1466966

    Description: epitope description:SALTSAIAGFVFSC antigen name:Antigen protein host organism:Ovis aries Merino X Border Leiscester

    Publication: 11085234;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston