Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 5 of 1,510,353 results for " "

  1. Synthetic peptides approach to identification of epitopes on bovine leukemia virus envelope glycoprotein gp51.

    ID: 1467041

    Description: epitope description:STVSSAPPTRVRR antigen name:gp60 SU host organism:Oryctolagus cuniculus antibody name:Anti-epitope rabbit sera

    Publication: 2466371;

  2. Synthetic peptides approach to identification of epitopes on bovine leukemia virus envelope glycoprotein gp51.

    ID: 1467045

    Description: epitope description:SAPPTRVRR antigen name:gp60 SU host organism:Oryctolagus cuniculus antibody name:Anti-epitope rabbit sera

    Publication: 2466371;

  3. Intranasal tolerance induction with polypeptides derived from 3 noncross-reactive major aeroallergens prevents allergic polysensitization in mice.

    ID: 1467259

    Description: epitope description:SKEMGETLLRAVESYLLAHSD antigen name:Bet v 1 host organism:Mus musculus BALB/c

    Publication: 16083792;

  4. Antibody responses to the env epitopes of human T-lymphotropic virus type I in rhesus macaques' naturally infected with simian T-lymphotropic virus ty...

    ID: 1467260

    Description: epitope description:SLLVDAPGYDPIWFLNTEPSQLPPTAPPLLPHSNLDHILEPSIPWKSK antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 8395074;

  5. Antibody responses to the env epitopes of human T-lymphotropic virus type I in rhesus macaques' naturally infected with simian T-lymphotropic virus ty...

    ID: 1467265

    Description: epitope description:SPNVSVPSSSSTPLLY antigen name:Envelope glycoprotein gp62 host organism:Macaca mulatta

    Publication: 8395074;
Displaying 5 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston