Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 20 of 1,510,353 results for " "

  1. Analysis of sequential immunoglobulin E-binding epitope of Japanese cedar pollen allergen (Cry j 2) in humans, monkeys and mice.

    ID: 1492431

    Description: epitope description:YVHVNGAKFIDTQNGLRIKT antigen name:Cry j 2 host organism:Macaca fuscata

    Publication: 12580914;

  2. Analysis of sequential immunoglobulin E-binding epitope of Japanese cedar pollen allergen (Cry j 2) in humans, monkeys and mice.

    ID: 1492448

    Description: epitope description:YCTSASACQNQRSAVQIQDV antigen name:Cry j 2 host organism:Mus musculus BDF1

    Publication: 12580914;

  3. Analysis of sequential immunoglobulin E-binding epitope of Japanese cedar pollen allergen (Cry j 2) in humans, monkeys and mice.

    ID: 1492459

    Description: epitope description:TAAAIQLKCSDSMPCKDIKL antigen name:Cry j 2 host organism:Homo sapiens

    Publication: 12580914;

  4. Analysis of sequential immunoglobulin E-binding epitope of Japanese cedar pollen allergen (Cry j 2) in humans, monkeys and mice.

    ID: 1492480

    Description: epitope description:GQCKWVNGREICNDRDRPTA antigen name:Cry j 2 host organism:Macaca fuscata

    Publication: 12580914;

  5. Analysis of sequential immunoglobulin E-binding epitope of Japanese cedar pollen allergen (Cry j 2) in humans, monkeys and mice.

    ID: 1492482

    Description: epitope description:KWVNGREI antigen name:Cry j 2 host organism:Homo sapiens

    Publication: 12580914;

  6. Variation of a newcastle disease virus hemagglutinin-neuraminidase linear epitope.

    ID: 1492493

    Description: epitope description:PDKQDYQIRKAKSS antigen name:Hemagglutinin-neuraminidase host organism:Gallus gallus

    Publication: 18272715;

  7. Complexity of the single linear neutralization epitope of the mouse arterivirus lactate dehydrogenase-elevating virus.

    ID: 1492495

    Description: epitope description:LSTENACAAGNS antigen name:major structural glycoprotein GP5 host organism:Mus musculus BALB/c

    Publication: 11882995;

  8. Identification of Fasciola hepatica recombinant 15-kDa fatty acid-binding protein T-cell epitopes that protect against experimental fascioliasis in ra...

    ID: 1492496

    Description: epitope description:VKAVTTLLKA antigen name:Other Fasciola hepatica (liver fluke) protein host organism:Mus musculus CD1 antibody name:Mouse sera

    Publication: 17918360;

  9. Identification of Fasciola hepatica recombinant 15-kDa fatty acid-binding protein T-cell epitopes that protect against experimental fascioliasis in ra...

    ID: 1492498

    Description: epitope description:VKAVTTLLKA antigen name:Other Fasciola hepatica (liver fluke) protein host organism:Oryctolagus cuniculus New Zealand White antibo...

    Publication: 17918360;

  10. Expression, structure, and location of epitopes of the major surface glycoprotein of Pneumocystis carinii f. sp. carinii.

    ID: 1492507

    Description: epitope description:GIIIGKSGVDLP antigen name:Pneumocystis carinii protein host organism:Mus musculus antibody name:RA-E7, RA-F1, RA-G10

    Publication: 9455880;

  11. Localization and fine mapping of antigenic sites on the nucleocapsid protein N of porcine reproductive and respiratory syndrome virus with monoclonal ...

    ID: 1492536

    Description: epitope description:AGKNQSQKKKK antigen name:Nucleoprotein host organism:Mus musculus antibody name:138.22

    Publication: 9875321;

  12. Presence of autologous neutralizing antibodies against cytomegalovirus (CMV) in serum of human immunodeficiency virus type 1-infected patients sheddin...

    ID: 1492542

    Description: epitope description:AGTQTPVNGNSPWAPTAPLPGDMNPANWPR antigen name:Tegument protein pp150 host organism:Homo sapiens

    Publication: 8169399;

  13. Localization and fine mapping of antigenic sites on the nucleocapsid protein N of porcine reproductive and respiratory syndrome virus with monoclonal ...

    ID: 1492544

    Description: epitope description:QLCQLL antigen name:Nucleoprotein host organism:Mus musculus antibody name:125.1, 126.9

    Publication: 9875321;

  14. Rotavirus neutralizing protein VP7: antigenic determinants investigated by sequence analysis and peptide synthesis.

    ID: 1492552

    Description: epitope description:ATEINDNSWKDTLS antigen name:Outer capsid glycoprotein VP7 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2582147;

  15. Rotavirus neutralizing protein VP7: antigenic determinants investigated by sequence analysis and peptide synthesis.

    ID: 1492557

    Description: epitope description:LTTDATTFEEVATAEKLV antigen name:Outer capsid glycoprotein VP7 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2582147;

  16. Localization and fine mapping of antigenic sites on the nucleocapsid protein N of porcine reproductive and respiratory syndrome virus with monoclonal ...

    ID: 1492559

    Description: epitope description:QLCQLL antigen name:Nucleoprotein host organism:Mus musculus antibody name:125.1, 126.9, NS95, NS99

    Publication: 9875321;

  17. Rotavirus neutralizing protein VP7: antigenic determinants investigated by sequence analysis and peptide synthesis.

    ID: 1492561

    Description: epitope description:RNCKKLGPRENVA antigen name:Outer capsid glycoprotein VP7 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2582147;

  18. Localization and fine mapping of antigenic sites on the nucleocapsid protein N of porcine reproductive and respiratory syndrome virus with monoclonal ...

    ID: 1492580

    Description: epitope description:P51, E52, K53, P54, H55, F56, P57, L58, A59, A60, E61, D62, D63, I64, R65, H66, H67, I80, Q81, T82, A83, F84, N85, Q86, G87, A88, ...

    Publication: 9875321;

  19. Epitope mapping of B-cell determinants on the 15-kilodalton lipoprotein of Treponema pallidum (Tpp15) with synthetic peptides.

    ID: 1492616

    Description: epitope description:VKRGGAFALC antigen name:UniProt:H6MQD5 host organism:Oryctolagus cuniculus

    Publication: 8698467;

  20. Epitope mapping of B-cell determinants on the 15-kilodalton lipoprotein of Treponema pallidum (Tpp15) with synthetic peptides.

    ID: 1492628

    Description: epitope description:KRGGAFALCL antigen name:UniProt:H6MQD5 host organism:Oryctolagus cuniculus

    Publication: 8698467;
Displaying 20 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston