Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Immunological fine structure of the variable and constant regions of a polymorphic malarial surface antigen from Plasmodium falciparum.

    ID: 1343307

    Description: epitope description:ETQNNSNV antigen name:Merozoite surface antigen 2 host organism:Mus musculus BALB/c

    Publication: 1779984;

  2. Immunological fine structure of the variable and constant regions of a polymorphic malarial surface antigen from Plasmodium falciparum.

    ID: 1343367

    Description: epitope description:ENKGTGQH antigen name:Other Plasmodium falciparum (malaria parasite P. falciparum) protein host organism:Mus musculus BALB/c

    Publication: 1779984;

  3. Immunological fine structure of the variable and constant regions of a polymorphic malarial surface antigen from Plasmodium falciparum.

    ID: 1343378

    Description: epitope description:SDSQKECT antigen name:Other Plasmodium falciparum (malaria parasite P. falciparum) protein host organism:Mus musculus BALB/c

    Publication: 1779984;

  4. Immunological fine structure of the variable and constant regions of a polymorphic malarial surface antigen from Plasmodium falciparum.

    ID: 1343381

    Description: epitope description:DGNKENCG antigen name:Other Plasmodium falciparum (malaria parasite P. falciparum) protein host organism:Mus musculus BALB/c

    Publication: 1779984;

  5. Immunological fine structure of the variable and constant regions of a polymorphic malarial surface antigen from Plasmodium falciparum.

    ID: 1343382

    Description: epitope description:NKENCGAA antigen name:Other Plasmodium falciparum (malaria parasite P. falciparum) protein host organism:Mus musculus BALB/c

    Publication: 1779984;

  6. Immunological fine structure of the variable and constant regions of a polymorphic malarial surface antigen from Plasmodium falciparum.

    ID: 1343386

    Description: epitope description:TSLLNNSS antigen name:Merozoite surface antigen 2 host organism:Mus musculus BALB/c

    Publication: 1779984;

  7. Immunological fine structure of the variable and constant regions of a polymorphic malarial surface antigen from Plasmodium falciparum.

    ID: 1343388

    Description: epitope description:NNSSNIAS antigen name:Merozoite surface antigen 2 host organism:Mus musculus BALB/c

    Publication: 1779984;

  8. Immunological fine structure of the variable and constant regions of a polymorphic malarial surface antigen from Plasmodium falciparum.

    ID: 1343390

    Description: epitope description:NIASINKF antigen name:Other Plasmodium falciparum (malaria parasite P. falciparum) protein host organism:Mus musculus BALB/c

    Publication: 1779984;

  9. Construction of a synthetic immunogen: use of the natural immunomodulator polytuftsin in malaria vaccines against RESA antigen of Plasmodium falciparu...

    ID: 1343467

    Description: epitope description:EENVEHDAEENVEHDA antigen name:DNAJ protein, putative host organism:Mus musculus

    Publication: 7526572;

  10. Immunogenicity and antigenicity in rabbits of a repeated sequence of Plasmodium falciparum antigen Pf155/RESA fused to two immunoglobulin G-binding do...

    ID: 1339000

    Description: epitope description:EENVEHDAEENVEHDAEENVEHDAEENVEHDA antigen name:DNAJ protein, putative host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2180822;

  11. Chemical characterization of the parasitophorous vacuole membrane antigen QF 116 from Plasmodium falciparum.

    ID: 1339037

    Description: epitope description:DNNLVSGP antigen name:Circumsporozoite-related antigen host organism:Mus musculus antibody name:8E7/55

    Publication: 1690855;

  12. Cytoadherence-related homologous motifs in Plasmodium falciparum antigen Pf155/RESA and erythrocyte band 3 protein.

    ID: 1339065

    Description: epitope description:WDEIMDIN antigen name:DNAJ protein, putative host organism:Homo sapiens

    Publication: 7596635;

  13. Cytoadherence-related homologous motifs in Plasmodium falciparum antigen Pf155/RESA and erythrocyte band 3 protein.

    ID: 1339068

    Description: epitope description:IMDINKRK antigen name:DNAJ protein, putative host organism:Homo sapiens

    Publication: 7596635;

  14. Cytoadherence-related homologous motifs in Plasmodium falciparum antigen Pf155/RESA and erythrocyte band 3 protein.

    ID: 1339074

    Description: epitope description:VQYDMPKE antigen name:DNAJ protein, putative host organism:Homo sapiens

    Publication: 7596635;

  15. Cytoadherence-related homologous motifs in Plasmodium falciparum antigen Pf155/RESA and erythrocyte band 3 protein.

    ID: 1339075

    Description: epitope description:QYDMPKEA antigen name:DNAJ protein, putative host organism:Homo sapiens

    Publication: 7596635;

  16. Cytoadherence-related homologous motifs in Plasmodium falciparum antigen Pf155/RESA and erythrocyte band 3 protein.

    ID: 1339083

    Description: epitope description:YESKWTQC antigen name:DNAJ protein, putative host organism:Homo sapiens

    Publication: 7596635;

  17. Cytoadherence-related homologous motifs in Plasmodium falciparum antigen Pf155/RESA and erythrocyte band 3 protein.

    ID: 1339087

    Description: epitope description:NKRKYDSL antigen name:DNAJ protein, putative host organism:Homo sapiens

    Publication: 7596635;

  18. Cytoadherence-related homologous motifs in Plasmodium falciparum antigen Pf155/RESA and erythrocyte band 3 protein.

    ID: 1339091

    Description: epitope description:SLKEKLQK antigen name:DNAJ protein, putative host organism:Homo sapiens

    Publication: 7596635;

  19. Cytoadherence-related homologous motifs in Plasmodium falciparum antigen Pf155/RESA and erythrocyte band 3 protein.

    ID: 1339229

    Description: epitope description:TYNYVLMV antigen name:Band 3 anion transport protein host organism:Homo sapiens

    Publication: 7596635;

  20. Cytoadherence-related homologous motifs in Plasmodium falciparum antigen Pf155/RESA and erythrocyte band 3 protein.

    ID: 1339235

    Description: epitope description:DVPYVKRV antigen name:Band 3 anion transport protein host organism:Homo sapiens

    Publication: 7596635;

  21. Cytoadherence-related homologous motifs in Plasmodium falciparum antigen Pf155/RESA and erythrocyte band 3 protein.

    ID: 1339258

    Description: epitope description:VLMVPKQG antigen name:Band 3 anion transport protein host organism:Homo sapiens

    Publication: 7596635;

  22. Cytoadherence-related homologous motifs in Plasmodium falciparum antigen Pf155/RESA and erythrocyte band 3 protein.

    ID: 1339260

    Description: epitope description:MVPKQGPL antigen name:Band 3 anion transport protein host organism:Homo sapiens

    Publication: 7596635;

  23. Cytoadherence-related homologous motifs in Plasmodium falciparum antigen Pf155/RESA and erythrocyte band 3 protein.

    ID: 1339266

    Description: epitope description:VPYVKRVK antigen name:Band 3 anion transport protein host organism:Homo sapiens

    Publication: 7596635;

  24. Cytoadherence-related homologous motifs in Plasmodium falciparum antigen Pf155/RESA and erythrocyte band 3 protein.

    ID: 1339268

    Description: epitope description:YVKRVKTW antigen name:Band 3 anion transport protein host organism:Homo sapiens

    Publication: 7596635;

  25. Cytoadherence-related homologous motifs in Plasmodium falciparum antigen Pf155/RESA and erythrocyte band 3 protein.

    ID: 1339270

    Description: epitope description:KRVKTWRM antigen name:Band 3 anion transport protein host organism:Homo sapiens

    Publication: 7596635;

  26. Immune responses in congenic mice to multiple antigen peptides based on defined epitopes from the malaria antigen Pf332.

    ID: 1339281

    Description: epitope description:VTEEIVTEEIVTEEI host organism:Mus musculus C57BL/10

    Publication: 8881768;

  27. Immune responses in congenic mice to multiple antigen peptides based on defined epitopes from the malaria antigen Pf332.

    ID: 1339292

    Description: epitope description:VTEEIVTEEIVTEEI host organism:Mus musculus BALB.B

    Publication: 8881768;

  28. Characterization of protective epitopes in a highly conserved Plasmodium falciparum antigenic protein containing repeats of acidic and basic residues.

    ID: 1339323

    Description: epitope description:NIISCNKNDKNQ antigen name:101 kDa malaria antigen host organism:Homo sapiens

    Publication: 9596765;

  29. Characterization of protective epitopes in a highly conserved Plasmodium falciparum antigenic protein containing repeats of acidic and basic residues.

    ID: 1339325

    Description: epitope description:YKAYVSYKKRKAQEK antigen name:101 kDa malaria antigen host organism:Homo sapiens

    Publication: 9596765;

  30. Characterization of protective epitopes in a highly conserved Plasmodium falciparum antigenic protein containing repeats of acidic and basic residues.

    ID: 1339326

    Description: epitope description:LKNKIFPKKKEDNQAVDT antigen name:101 kDa malaria antigen host organism:Homo sapiens

    Publication: 9596765;

  31. Characterization of protective epitopes in a highly conserved Plasmodium falciparum antigenic protein containing repeats of acidic and basic residues.

    ID: 1339339

    Description: epitope description:NIISCNKNDKNQ antigen name:101 kDa malaria antigen host organism:Oryctolagus cuniculus

    Publication: 9596765;

  32. Characterization of protective epitopes in a highly conserved Plasmodium falciparum antigenic protein containing repeats of acidic and basic residues.

    ID: 1339341

    Description: epitope description:YKAYVSYKKRKAQEK antigen name:101 kDa malaria antigen host organism:Oryctolagus cuniculus

    Publication: 9596765;

  33. Characterization of protective epitopes in a highly conserved Plasmodium falciparum antigenic protein containing repeats of acidic and basic residues.

    ID: 1339346

    Description: epitope description:KEEKEEKEEKEEKEKEKE antigen name:Uncharacterized protein MAL13P1.304 host organism:Oryctolagus cuniculus

    Publication: 9596765;

  34. Protection against malaria by immunization with plasmid DNA encoding circumsporozoite protein.

    ID: 1339347

    Description: epitope description:QGPGAPQGPGAP antigen name:Circumsporozoite protein (UniProt:Q7RJT9) host organism:Mus musculus BALB/cByJ

    Publication: 7937907;

  35. Characterization of protective epitopes in a highly conserved Plasmodium falciparum antigenic protein containing repeats of acidic and basic residues.

    ID: 1339368

    Description: epitope description:VPPTQSKKKNKNET antigen name:101 kDa malaria antigen host organism:Oryctolagus cuniculus

    Publication: 9596765;

  36. Characterization of protective epitopes in a highly conserved Plasmodium falciparum antigenic protein containing repeats of acidic and basic residues.

    ID: 1339373

    Description: epitope description:KEEKEEKEEKEEKEKEKE antigen name:Uncharacterized protein MAL13P1.304 host organism:Oryctolagus cuniculus

    Publication: 9596765;

  37. Multiple T helper cell epitopes of the circumsporozoite protein of Plasmodium berghei.

    ID: 1339374

    Description: epitope description:DPPPPNPNDPPPPNPND antigen name:Circumsporozoite (CS) protein, putative host organism:Mus musculus

    Publication: 2464495;

  38. Immunogenicity of a non-repetitive sequence of Plasmodium falciparum circumsporozoite protein in man and mice.

    ID: 1339453

    Description: epitope description:KPKHKKLKQPGDGNP antigen name:Circumsporozoite (CS) protein host organism:Mus musculus CBA/Ca

    Publication: 2450833;

  39. Recognition of different domains of the Plasmodium falciparum CS protein by the sera of naturally infected individuals compared with those of sporozoi...

    ID: 1339460

    Description: epitope description:SVTCGNGIQVRIKPGSANKPKDELDYENDIEKKICKMEKCSSVFNVV antigen name:Circumsporozoite (CS) protein host organism:Saimiri sciureus

    Publication: 1401909;

  40. Recognition of different domains of the Plasmodium falciparum CS protein by the sera of naturally infected individuals compared with those of sporozoi...

    ID: 1339468

    Description: epitope description:DPNANPNVDPNANPNV antigen name:Circumsporozoite (CS) protein host organism:Homo sapiens

    Publication: 1401909;

  41. Development, expression, and murine testing of a multistage Plasmodium falciparum malaria vaccine candidate.

    ID: 1339469

    Description: epitope description:KPLDKFGNIYDYHYEH antigen name:Plasmodium falciparum gamete antigen 27/25 host organism:Mus musculus

    Publication: 10812234;

  42. Recognition of different domains of the Plasmodium falciparum CS protein by the sera of naturally infected individuals compared with those of sporozoi...

    ID: 1339470

    Description: epitope description:PSDKHIEQYLKKIQNSLS antigen name:Circumsporozoite (CS) protein host organism:Saimiri sciureus

    Publication: 1401909;

  43. Recognition of different domains of the Plasmodium falciparum CS protein by the sera of naturally infected individuals compared with those of sporozoi...

    ID: 1339472

    Description: epitope description:PSDKHIEQYLKKIQNSLS antigen name:Circumsporozoite (CS) protein host organism:Homo sapiens

    Publication: 1401909;

  44. Recognition of different domains of the Plasmodium falciparum CS protein by the sera of naturally infected individuals compared with those of sporozoi...

    ID: 1339476

    Description: epitope description:IKPGSANKPKDELDYENDIE antigen name:Circumsporozoite (CS) protein host organism:Saimiri sciureus

    Publication: 1401909;

  45. T-cell immunity to peptide epitopes of liver-stage antigen 1 in an area of Papua New Guinea in which malaria is holoendemic.

    ID: 1339675

    Description: epitope description:LTMSNVKNVQTNFKSLLRNLGVS antigen name:Other Plasmodium falciparum (malaria parasite P. falciparum) protein host organism:Homo sapie...

    Publication: 9393799;

  46. Induction of protective immune responses by immunization with linear multiepitope peptides based on conserved sequences from Plasmodium falciparum ant...

    ID: 1339788

    Description: epitope description:IEQYLKKIKNSISTEWSPCSVTCGKGTRSRKR host organism:Mus musculus FVB

    Publication: 9632590;

  47. High immunogenicity in chimpanzees of peptides and lipopeptides derived from four new Plasmodium falciparum pre-erythrocytic molecules.

    ID: 1339849

    Description: epitope description:NGKDDVKEEKKTNEKKDDGKTDKVQEKVLEKSPK antigen name:Merozoite surface protein 4 host organism:Pan troglodytes

    Publication: 10812228;

  48. High immunogenicity in chimpanzees of peptides and lipopeptides derived from four new Plasmodium falciparum pre-erythrocytic molecules.

    ID: 1339851

    Description: epitope description:STDNNNTKTISTDNNNTKTI antigen name:STARP antigen host organism:Pan troglodytes

    Publication: 10812228;

  49. Induction of protective immune responses by immunization with linear multiepitope peptides based on conserved sequences from Plasmodium falciparum ant...

    ID: 1339883

    Description: epitope description:KPKDELDYENDIEKKICKMEKCS antigen name:Circumsporozoite (CS) protein host organism:Mus musculus BALB/c

    Publication: 9632590;

  50. Rationale for development of a synthetic vaccine against Plasmodium falciparum malaria.

    ID: 1339889

    Description: epitope description:NANPNANP antigen name:Circumsporozoite (CS) protein host organism:Mus musculus antibody name:2C11, 3D6

    Publication: 2409595;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston