Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 100 of 1,510,353 results for " "

  1. Linear and conformation specific antibodies in aged beagles after prolonged vaccination with aggregated Abeta.

    ID: 1797783

    Description: epitope description:HDSGYEVHHQKLVFF antigen name:Amyloid beta A4 protein host organism:Canis familiaris beagle

    Publication: 20451612;

  2. Linear and conformation specific antibodies in aged beagles after prolonged vaccination with aggregated Abeta.

    ID: 1797785

    Description: epitope description:KLVFFAEDVGSNKGA antigen name:Amyloid beta A4 protein host organism:Canis familiaris beagle

    Publication: 20451612;

  3. Linear and conformation specific antibodies in aged beagles after prolonged vaccination with aggregated Abeta.

    ID: 1797787

    Description: epitope description:SNKGAIIGLMVGGVVIA antigen name:Amyloid beta A4 protein host organism:Canis familiaris beagle

    Publication: 20451612;

  4. Autoantibodies to OxLDL fail to alter the clearance of injected OxLDL in apolipoprotein E-deficient mice.

    ID: 1797815

    Description: epitope description:oxidised LDL host organism:Mus musculus Apolipoprotein E null antibody name:EO6

    Publication: 15102879;

  5. Sulfation of heparan sulfate associated with amyloid-beta plaques in patients with Alzheimer's disease.

    ID: 1797820

    Description: epitope description:heparan sulfate host organism:Mus musculus antibody name:HS4C3

    Publication: 19636575;

  6. The continuous antigenic regions in the second domain of the beta chain of human MHC DR2 antigen: antigenic profile of the entire extracellular part o...

    ID: 1797841

    Description: epitope description:VYPSKTQPLQHHNLL antigen name:HLA class II histocompatibility antigen, DRB1-16 beta chain host organism:Mus musculus

    Publication: 2439349;

  7. The continuous antigenic regions in the second domain of the beta chain of human MHC DR2 antigen: antigenic profile of the entire extracellular part o...

    ID: 1797847

    Description: epitope description:WFLNGQEEKAGGVST antigen name:Other Homo sapiens (human) protein host organism:Mus musculus

    Publication: 2439349;

  8. The continuous antigenic regions in the second domain of the beta chain of human MHC DR2 antigen: antigenic profile of the entire extracellular part o...

    ID: 1797849

    Description: epitope description:GGVSTGLIQDDWTFQ antigen name:Other Homo sapiens (human) protein host organism:Mus musculus

    Publication: 2439349;

  9. The continuous antigenic regions in the second domain of the beta chain of human MHC DR2 antigen: antigenic profile of the entire extracellular part o...

    ID: 1797853

    Description: epitope description:ETVPRSGEVYTSQVE antigen name:Other Homo sapiens (human) protein host organism:Mus musculus

    Publication: 2439349;

  10. Mast cells contribute to the mucosal adjuvant effect of CTA1-DD after IgG-complex formation.

    ID: 1797863

    Description: epitope description:(4-hydroxy-3-nitrophenyl)acetyl group host organism:Mus musculus C57BL/6

    Publication: 20675596;

  11. The immunodominant epitope of centromere-associated protein A displays homology with the transcription factor forkhead box E3 (FOXE3).

    ID: 1797961

    Description: epitope description:SPSPTPTPGPSRRG antigen name:Histone H3-like centromeric protein A host organism:Homo sapiens

    Publication: 20630806;

  12. Carbamylation-dependent activation of T cells: a novel mechanism in the pathogenesis of autoimmune arthritis.

    ID: 1797995

    Description: epitope description:HQCHQESTKGKSKGKCGKSGS + CITR(K9) antigen name:Other Mus musculus (mouse) protein host organism:Mus musculus NMRI

    Publication: 20488785;

  13. Carbamylation-dependent activation of T cells: a novel mechanism in the pathogenesis of autoimmune arthritis.

    ID: 1797998

    Description: epitope description:HQCHQESTGRSRGRCGRSGS + CITR(R10) antigen name:Other Mus musculus (mouse) protein host organism:Mus musculus NMRI

    Publication: 20488785;

  14. Carbamylation-dependent activation of T cells: a novel mechanism in the pathogenesis of autoimmune arthritis.

    ID: 1798000

    Description: epitope description:HQCHQESTKGKSKGKCGKSGS antigen name:Other Mus musculus (mouse) protein host organism:Mus musculus NMRI

    Publication: 20488785;

  15. Carbamylation-dependent activation of T cells: a novel mechanism in the pathogenesis of autoimmune arthritis.

    ID: 1798005

    Description: epitope description:HQCHQESTGRSRGRCGRSGS + CITR(R10) antigen name:Other Mus musculus (mouse) protein host organism:Mus musculus NMRI

    Publication: 20488785;

  16. Production of antibodies against murine class II antigens using unconjugated synthetic peptides of the beta chain region 63-78.

    ID: 1798010

    Description: epitope description:SQPEILEDARASVDTY antigen name:H-2 class II histocompatibility antigen, E-D beta chain host organism:Mus musculus C57BL/6 X 129

    Publication: 2844910;

  17. Carbamylation-dependent activation of T cells: a novel mechanism in the pathogenesis of autoimmune arthritis.

    ID: 1798013

    Description: epitope description:HQCHQESTKGKSKGKCGKSGS antigen name:Other Mus musculus (mouse) protein host organism:Mus musculus NMRI

    Publication: 20488785;

  18. N (epsilon)-(carboxymethyl)lysine protein adduct is a major immunological epitope in proteins modified with advanced glycation end products of the Mai...

    ID: 1798022

    Description: epitope description:N(6)-acetonyllysine host organism:Mus musculus BALB/c antibody name:6D12

    Publication: 8672512;

  19. N (epsilon)-(carboxymethyl)lysine protein adduct is a major immunological epitope in proteins modified with advanced glycation end products of the Mai...

    ID: 1798025

    Description: epitope description:N(6)-carboxymethyl-L-lysine host organism:Oryctolagus cuniculus

    Publication: 8672512;

  20. The immunodominant epitope of centromere-associated protein A displays homology with the transcription factor forkhead box E3 (FOXE3).

    ID: 1798027

    Description: epitope description:PTPETGPLQR antigen name:Condensin-2 complex subunit D3 host organism:Homo sapiens

    Publication: 20630806;

  21. The immunodominant epitope of centromere-associated protein A displays homology with the transcription factor forkhead box E3 (FOXE3).

    ID: 1798030

    Description: epitope description:SPSPTPTPGPSRRG antigen name:Histone H3-like centromeric protein A host organism:Homo sapiens

    Publication: 20630806;

  22. Monoclonal antibodies raised against membrane glycoproteins from mouse brain recognize N-linked oligomannosidic glycans.

    ID: 1798034

    Description: epitope description:alpha-D-Manp-(1->3)-[alpha-D-Manp-(1->3)-[alpha-D-Manp-(1->6)]-alpha-D-Manp-(1->6)]-D-Manp antigen name:N-glycoprotein host organi...

    Publication: 7510547;

  23. Identification of an IgE-binding epitope of a major buckwheat allergen, BWp16, by SPOTs assay and mimotope screening.

    ID: 1798039

    Description: epitope description:EGVRDLKE antigen name:Fag e 2 host organism:Homo sapiens

    Publication: 20407269;

  24. Identification of an IgE-binding epitope of a major buckwheat allergen, BWp16, by SPOTs assay and mimotope screening.

    ID: 1798052

    Description: epitope description:FDLGETQMSSKC antigen name:Fag e 2 host organism:Homo sapiens

    Publication: 20407269;

  25. Identification of an IgE-binding epitope of a major buckwheat allergen, BWp16, by SPOTs assay and mimotope screening.

    ID: 1798082

    Description: epitope description:NRYIAMDILDDK antigen name:Fag e 2 host organism:Homo sapiens

    Publication: 20407269;

  26. The immunodominant epitope of centromere-associated protein A displays homology with the transcription factor forkhead box E3 (FOXE3).

    ID: 1798091

    Description: epitope description:PTPAPGPGRR antigen name:Forkhead box protein E3 host organism:Mus musculus BALB/c

    Publication: 20630806;

  27. Identification of an IgE-binding epitope of a major buckwheat allergen, BWp16, by SPOTs assay and mimotope screening.

    ID: 1798096

    Description: epitope description:EALSRVEGEGCK antigen name:Fag e 2 host organism:Homo sapiens

    Publication: 20407269;

  28. Identification of an IgE-binding epitope of a major buckwheat allergen, BWp16, by SPOTs assay and mimotope screening.

    ID: 1798100

    Description: epitope description:RVEGEGCKSEES antigen name:Fag e 2 host organism:Homo sapiens

    Publication: 20407269;

  29. Identification of an IgE-binding epitope of a major buckwheat allergen, BWp16, by SPOTs assay and mimotope screening.

    ID: 1798102

    Description: epitope description:EGEGCKSEESCM antigen name:Fag e 2 host organism:Homo sapiens

    Publication: 20407269;

  30. Identification of an IgE-binding epitope of a major buckwheat allergen, BWp16, by SPOTs assay and mimotope screening.

    ID: 1798113

    Description: epitope description:CMRGCCVAMKEM antigen name:Fag e 2 host organism:Homo sapiens

    Publication: 20407269;

  31. Experimental immunity to the G1 domain of the proteoglycan versican induces spondylitis and sacroiliitis, of a kind seen in human spondylarthropathies...

    ID: 1795497

    Description: epitope description:GCYGDKMGKAGVRTYGFRSPQETYD antigen name:Versican core protein (UniProt:P13611) host organism:Mus musculus BALB/c

    Publication: 14558097;

  32. Experimental immunity to the G1 domain of the proteoglycan versican induces spondylitis and sacroiliitis, of a kind seen in human spondylarthropathies...

    ID: 1795502

    Description: epitope description:FDQCDYGWLSDASVRHPVTVARAQC antigen name:Versican core protein (UniProt:P13611) host organism:Mus musculus BALB/c

    Publication: 14558097;

  33. Experimental immunity to the G1 domain of the proteoglycan versican induces spondylitis and sacroiliitis, of a kind seen in human spondylarthropathies...

    ID: 1795504

    Description: epitope description:GVRTLYRFENQTGFPPPDSRFDAYC antigen name:Versican core protein (UniProt:P13611) host organism:Mus musculus BALB/c

    Publication: 14558097;

  34. Experimental immunity to the G1 domain of the proteoglycan versican induces spondylitis and sacroiliitis, of a kind seen in human spondylarthropathies...

    ID: 1795513

    Description: epitope description:IATPEQLQAAYEDGFHQCDAGWL antigen name:Aggrecan core protein host organism:Mus musculus BALB/c

    Publication: 14558097;

  35. Molecular mimicry between an immunodominant amino acid motif on the 47-kDa lipoprotein of Treponema pallidum (Tpp47) and multiple repeats of analogous...

    ID: 1795519

    Description: epitope description:PGSEYT antigen name:Embryo-specific fibronectin 1 transcript variant host organism:Oryctolagus cuniculus New Zealand White

    Publication: 8752922;

  36. Molecular mimicry between an immunodominant amino acid motif on the 47-kDa lipoprotein of Treponema pallidum (Tpp47) and multiple repeats of analogous...

    ID: 1795520

    Description: epitope description:PGSEYT antigen name:Embryo-specific fibronectin 1 transcript variant host organism:Oryctolagus cuniculus New Zealand White

    Publication: 8752922;

  37. Molecular mimicry between an immunodominant amino acid motif on the 47-kDa lipoprotein of Treponema pallidum (Tpp47) and multiple repeats of analogous...

    ID: 1795525

    Description: epitope description:PGTEYT antigen name:Fibronectin host organism:Oryctolagus cuniculus New Zealand White

    Publication: 8752922;

  38. Molecular mimicry between an immunodominant amino acid motif on the 47-kDa lipoprotein of Treponema pallidum (Tpp47) and multiple repeats of analogous...

    ID: 1795527

    Description: epitope description:PGSEYT antigen name:Embryo-specific fibronectin 1 transcript variant host organism:Oryctolagus cuniculus New Zealand White

    Publication: 8752922;

  39. Naturally-occurring human serum antibodies to inner core lipopolysaccharide epitopes of Neisseria meningitidis protect against invasive meningococcal ...

    ID: 1795539

    Description: epitope description:D-Glcp-(1->3)-[alpha-D-GlcpNAc-(1->2)]-6-PEA-L-alpha-D-Hepp-(1->3)-L-alpha-D-Hepp-(1->5)-[alpha-Kdo-(2->4)]-alpha-Kdo antigen name...

    Publication: 18835574;

  40. Diclofenac-induced antibodies against red blood cells are heterogeneous and recognize different epitopes.

    ID: 1795553

    Description: epitope description:diclofenac host organism:Homo sapiens

    Publication: 15265128;

  41. Prolonged survival of GalT-KO swine skin on baboons.

    ID: 1795591

    Description: epitope description:alpha-D-Galp-(1->3)-beta-D-Galp-(1->4)-D-GlcpNAc-yl group host organism:Papio anubis

    Publication: 20522247;

  42. Development of peptide mimics of a protective epitope of Vibrio cholerae Ogawa O-antigen and investigation of the structural basis of peptide mimicry.

    ID: 1795618

    Description: epitope description:NHNYPPLSLLTF host organism:Mus musculus BALB/c antibody name:S-20-4 and A-20-6

    Publication: 17881351;

  43. Development of peptide mimics of a protective epitope of Vibrio cholerae Ogawa O-antigen and investigation of the structural basis of peptide mimicry.

    ID: 1795623

    Description: epitope description:NHNYPPLSLLTF host organism:Mus musculus BALB/c

    Publication: 17881351;

  44. Development of peptide mimics of a protective epitope of Vibrio cholerae Ogawa O-antigen and investigation of the structural basis of peptide mimicry.

    ID: 1795624

    Description: epitope description:NHNYPPLSLLTF host organism:Mus musculus BALB/c

    Publication: 17881351;

  45. The p68 autoantigen characteristic of rheumatoid arthritis is reactive with carbohydrate epitope specific autoantibodies.

    ID: 1795648

    Description: epitope description:N-acetyl-D-glucosamine host organism:Oryctolagus cuniculus

    Publication: 9709178;

  46. HLA-DRB genotype and specific IgE responses in patients with allergies to penicillins.

    ID: 1795654

    Description: epitope description:benzylpenicillanyl group host organism:Homo sapiens

    Publication: 16584643;

  47. HLA-DRB genotype and specific IgE responses in patients with allergies to penicillins.

    ID: 1795658

    Description: epitope description:phenoxymethylpenicillanyl group host organism:Homo sapiens

    Publication: 16584643;

  48. HLA-DRB genotype and specific IgE responses in patients with allergies to penicillins.

    ID: 1795660

    Description: epitope description:ampicillanyl group host organism:Homo sapiens

    Publication: 16584643;

  49. HLA-DRB genotype and specific IgE responses in patients with allergies to penicillins.

    ID: 1795662

    Description: epitope description:amoxicillanyl group host organism:Homo sapiens

    Publication: 16584643;

  50. Glycolipid studies in small intestine and pancreas of alpha1,3-galactosyltransferase knockout miniature swine: alpha1,3GALT-KO animals lack alphaGAL a...

    ID: 1795663

    Description: epitope description:alpha-D-galactosyl-(1->3)-D-galactosyl group antigen name:glycolipid host organism:Homo sapiens

    Publication: 18374124;

  51. Depressed primary in vitro antibody response in rheumatoid arthritis.

    ID: 1795672

    Description: epitope description:2,4,6-trinitrophenyl group host organism:Homo sapiens

    Publication: 159147;

  52. A monoclonal autoantibody that promotes central nervous system remyelination in a model of multiple sclerosis is a natural autoantibody encoded by ger...

    ID: 1795698

    Description: epitope description:fluorescein host organism:Mus musculus SJL antibody name:SCH94.03

    Publication: 7868912;

  53. A monoclonal autoantibody that promotes central nervous system remyelination in a model of multiple sclerosis is a natural autoantibody encoded by ger...

    ID: 1795699

    Description: epitope description:fluorescein host organism:Mus musculus SJL antibody name:SCH94.03

    Publication: 7868912;

  54. Mechanism for increased immunogenicity of vaccines that form in vivo immune complexes with the natural anti-Gal antibody.

    ID: 1795747

    Description: epitope description:alpha-D-Galp-(1->3)-beta-D-Galp-(1->4)-D-GlcpNAc-yl group host organism:Mus musculus C57BL/6 alpha1,3GT null

    Publication: 19428921;

  55. Characterization of a cashew allergen, 11S globulin (Ana o 2), conformational epitope.

    ID: 1795752

    Description: epitope description:EESEDEKRRWGQRDN antigen name:Ana o 2 host organism:Mus musculus BALB/c antibody name:1F5

    Publication: 20362336;

  56. Structural characterization of the epitope recognized by the new anti-Fy6 monoclonal antibody NaM 185-2C3.

    ID: 1795785

    Description: epitope description:FEDVW antigen name:Atypical chemokine receptor 1 host organism:Mus musculus BALB/c antibody name:NaM185-2C3

    Publication: 12164140;

  57. Degenerate interfaces in antigen-antibody complexes.

    ID: 1795807

    Description: epitope description:E53, N64, T65, D66, S68, D70, Q75, I76, N77, R79, W80, W81, R91, L93, I116, D119, N121, N124, A125, W126, V127, R130, K134 antigen...

    Publication: 11676532;

  58. A 13-mer peptide straddling the leucine33/proline33 polymorphism in glycoprotein IIIa does not define the PLA1 epitope.

    ID: 1795826

    Description: epitope description:SDEALPLGSPRCD antigen name:Integrin beta-3 host organism:Mus musculus

    Publication: 1708295;

  59. A 13-mer peptide straddling the leucine33/proline33 polymorphism in glycoprotein IIIa does not define the PLA1 epitope.

    ID: 1795827

    Description: epitope description:SDEALPPGSPRCD antigen name:Integrin beta-3 host organism:Mus musculus

    Publication: 1708295;

  60. Distribution of the alphaGal- and the non-alphaGal T-antigens in the pig kidney: potential targets for rejection in pig-to-man xenotransplantation.

    ID: 1795837

    Description: epitope description:beta-D-Galp-(1->3)-D-GalpNAc host organism:Mus musculus BALB/c antibody name:3C9

    Publication: 18301385;

  61. Production and characterization of a peptide specific, anti-major histocompatibility complex class II, monoclonal antibody.

    ID: 1795929

    Description: epitope description:AEYWNSQPEILERTRAELDTVCRHNYEGPETH antigen name:H-2 class II histocompatibility antigen, A beta chain host organism:Cricetulus migra...

    Publication: 1648172;

  62. Crystal structure of the human beta2 adrenergic G-protein-coupled receptor.

    ID: 1795941

    Description: epitope description:I233, D234, K235, S236, E237, G238, R239, F240, H241, V242, L266, K270 antigen name:Beta-2 adrenergic receptor host organism:Mus m...

    Publication: 17952055;

  63. A novel hepatitis B virus variant S 129 (Gln-->Leu): lack of correlation between antigenicity and immunogenicity.

    ID: 1795991

    Description: epitope description:Q129 antigen name:Large envelope protein host organism:Mus musculus BALB/c

    Publication: 10534722;

  64. Synthetic galactocerebrosides evoke myelination-inhibiting antibodies.

    ID: 1796006

    Description: epitope description:D-galactose host organism:Oryctolagus cuniculus New Zealand White

    Publication: 831265;

  65. Carbamylation-dependent activation of T cells: a novel mechanism in the pathogenesis of autoimmune arthritis.

    ID: 1796016

    Description: epitope description:HQCHQESTKGKSKGKCGKSGS antigen name:Other Mus musculus (mouse) protein host organism:Mus musculus NMRI

    Publication: 20488785;

  66. Carbamylation-dependent activation of T cells: a novel mechanism in the pathogenesis of autoimmune arthritis.

    ID: 1796019

    Description: epitope description:SHQESTKGKSKGKSGKSGS antigen name:Other Mus musculus (mouse) protein host organism:Mus musculus NMRI

    Publication: 20488785;

  67. Carbamylation-dependent activation of T cells: a novel mechanism in the pathogenesis of autoimmune arthritis.

    ID: 1796041

    Description: epitope description:HQCHQESTKGKSKGKCGKSGS + CITR(K9) antigen name:Other Mus musculus (mouse) protein host organism:Mus musculus NMRI

    Publication: 20488785;

  68. Carbamylation-dependent activation of T cells: a novel mechanism in the pathogenesis of autoimmune arthritis.

    ID: 1796050

    Description: epitope description:HQCHQESTKGKSKGKCGKSGS + CITR(K9) antigen name:Other Mus musculus (mouse) protein host organism:Homo sapiens

    Publication: 20488785;

  69. New insights into the conformational dominant epitopes on thyroid peroxidase recognized by human autoantibodies.

    ID: 1796056

    Description: epitope description:RYSDLLMAWGQYIDHDIA antigen name:Thyroid peroxidase (UniProt:P07202) host organism:Oryctolagus cuniculus New Zealand White antibody...

    Publication: 15761037;

  70. New insights into the conformational dominant epitopes on thyroid peroxidase recognized by human autoantibodies.

    ID: 1796077

    Description: epitope description:LQVQDQLMNEELTER antigen name:Thyroid peroxidase (UniProt:P07202) host organism:Oryctolagus cuniculus New Zealand White antibody na...

    Publication: 15761037;

  71. New insights into the conformational dominant epitopes on thyroid peroxidase recognized by human autoantibodies.

    ID: 1796083

    Description: epitope description:EDFESCDSITGMNLEA antigen name:Thyroid peroxidase (UniProt:P07202) host organism:Oryctolagus cuniculus New Zealand White antibody n...

    Publication: 15761037;

  72. Mapping of the binding specificity for five monoclonal antibodies recognizing 3-deoxy-D-manno-octulosonic acid in bacterial lipopolysaccharides.

    ID: 1796086

    Description: epitope description:alpha-Kdo-(2->4)-alpha-Kdo antigen name:lipopolysaccharide host organism:Mus musculus BALB/c antibody name:MASM 1

    Publication: 2033255;

  73. Mapping of the binding specificity for five monoclonal antibodies recognizing 3-deoxy-D-manno-octulosonic acid in bacterial lipopolysaccharides.

    ID: 1796088

    Description: epitope description:alpha-Kdo-(2->4)-alpha-Kdo antigen name:lipopolysaccharide host organism:Mus musculus BALB/c antibody name:MAEC 7

    Publication: 2033255;

  74. Characterization of monoclonal anti-beta2-glycoprotein-I and anti-prothrombin antibody fragments generated by phage display from a patient with primar...

    ID: 1796103

    Description: epitope description:sphingomyelin d18:1 host organism:Homo sapiens antibody name:Beta 1, Beta 2, Prot 1

    Publication: 16330187;

  75. New insights into the conformational dominant epitopes on thyroid peroxidase recognized by human autoantibodies.

    ID: 1796108

    Description: epitope description:LQVQDQLMNEELTER antigen name:Thyroid peroxidase (UniProt:P07202) host organism:Oryctolagus cuniculus New Zealand White antibody na...

    Publication: 15761037;

  76. Structural characterization of the epitope recognized by the new anti-Fy6 monoclonal antibody NaM 185-2C3.

    ID: 1796120

    Description: epitope description:FEDVW antigen name:Atypical chemokine receptor 1 host organism:Mus musculus BALB/c antibody name:NaM185-2C3

    Publication: 12164140;

  77. New insights into the conformational dominant epitopes on thyroid peroxidase recognized by human autoantibodies.

    ID: 1796122

    Description: epitope description:KFP antigen name:Thyroid peroxidase (UniProt:P07202) host organism:Oryctolagus cuniculus New Zealand White antibody name:Anti-P43

    Publication: 15761037;

  78. Structure of the O-polysaccharide and serological cross-reactivity of the Providencia stuartii O33 lipopolysaccharide containing 4-(N-acetyl-D-aspart-...

    ID: 1796129

    Description: epitope description:P. stuartii O33 O-specific polysaccharide antigen name:lipopolysaccharide host organism:Oryctolagus cuniculus New Zealand White

    Publication: 15145457;

  79. New insights into the conformational dominant epitopes on thyroid peroxidase recognized by human autoantibodies.

    ID: 1796143

    Description: epitope description:TAIASRSV antigen name:Thyroid peroxidase (UniProt:P07202) host organism:Homo sapiens antibody name:TR1.8

    Publication: 15761037;

  80. Exploring the capacity of minimalist protein interfaces: interface energetics and affinity maturation to picomolar KD of a single-domain antibody with...

    ID: 1796308

    Description: epitope description:S85, Q86, K87, N88, V89, A90, Q95, T96, N97, Y99, Y102, C136, E137, G138, Y141 antigen name:Ribonuclease pancreatic host organism:...

    Publication: 17888451;

  81. Ana o 2, a major cashew (Anacardium occidentale L.) nut allergen of the legumin family.

    ID: 1796358

    Description: epitope description:RLIKQLKSEDNRGGI antigen name:Ana o 2 host organism:Homo sapiens

    Publication: 14555856;

  82. Ana o 2, a major cashew (Anacardium occidentale L.) nut allergen of the legumin family.

    ID: 1796365

    Description: epitope description:QNFAVVKRAREERFE antigen name:Ana o 2 host organism:Homo sapiens

    Publication: 14555856;

  83. Ana o 2, a major cashew (Anacardium occidentale L.) nut allergen of the legumin family.

    ID: 1796371

    Description: epitope description:YEAGTVEAWDPNHEQ antigen name:Ana o 2 host organism:Homo sapiens

    Publication: 14555856;

  84. Ana o 2, a major cashew (Anacardium occidentale L.) nut allergen of the legumin family.

    ID: 1796383

    Description: epitope description:QSRGRNLFSGFDTEL antigen name:Ana o 2 host organism:Homo sapiens

    Publication: 14555856;

  85. Ana o 2, a major cashew (Anacardium occidentale L.) nut allergen of the legumin family.

    ID: 1796385

    Description: epitope description:AEAFQVDERLIKQLK antigen name:Ana o 2 host organism:Homo sapiens

    Publication: 14555856;

  86. Ana o 2, a major cashew (Anacardium occidentale L.) nut allergen of the legumin family.

    ID: 1796388

    Description: epitope description:SERGSESEEESEDEK antigen name:Ana o 2 host organism:Homo sapiens

    Publication: 14555856;

  87. Ana o 2, a major cashew (Anacardium occidentale L.) nut allergen of the legumin family.

    ID: 1796389

    Description: epitope description:RWGQRDNGIEETICT antigen name:Ana o 2 host organism:Homo sapiens

    Publication: 14555856;

  88. Ana o 2, a major cashew (Anacardium occidentale L.) nut allergen of the legumin family.

    ID: 1796392

    Description: epitope description:PARADIYTPEVGRLT antigen name:Ana o 2 host organism:Homo sapiens

    Publication: 14555856;

  89. Ana o 2, a major cashew (Anacardium occidentale L.) nut allergen of the legumin family.

    ID: 1796397

    Description: epitope description:QVVDNFGNRVFDGEV antigen name:Ana o 2 host organism:Homo sapiens

    Publication: 14555856;

  90. Human major histocompatibility complex class I antigens: residues 61-83 of the HLA-B7 heavy chain specify an alloreactive site.

    ID: 1796405

    Description: epitope description:DRNTQIYKAQAQTDRESLRNLRG antigen name:HLA class I histocompatibility antigen, B-7 alpha chain host organism:Oryctolagus cuniculus

    Publication: 3881768;

  91. Immune response to small intestinal submucosa (surgisis) implant in humans: preliminary observations.

    ID: 1796407

    Description: epitope description:alpha-D-Galp-(1->3)-beta-D-Galp-(1->4)-D-GlcpNAc-yl group host organism:Homo sapiens

    Publication: 17710604;

  92. Characterization of high affinity monoclonal antibodies specific for chlamydial lipopolysaccharide.

    ID: 1796472

    Description: epitope description:alpha-Kdo-(2->8)-alpha-Kdo-(2->4)-alpha-Kdo antigen name:lipopolysaccharide host organism:Mus musculus BALB/c antibody name:S25-23

    Publication: 10642603;

  93. Characterization of high affinity monoclonal antibodies specific for chlamydial lipopolysaccharide.

    ID: 1796473

    Description: epitope description:alpha-Kdo-(2->8)-alpha-Kdo-(2->4)-alpha-Kdo antigen name:lipopolysaccharide host organism:Mus musculus BALB/c antibody name:S25-23

    Publication: 10642603;

  94. Main immunogenic region structure promotes binding of conformation-dependent myasthenia gravis autoantibodies, nicotinic acetylcholine receptor confor...

    ID: 1796477

    Description: epitope description:E22, H23, E24, T25, R26, L27, V28, A29, K30, L31, F32, K33, D34, W80, V81, D82, Y83, N84, L85, K86, W87, N88, P89, D90, D91, Y92, ...

    Publication: 19890000;

  95. Main immunogenic region structure promotes binding of conformation-dependent myasthenia gravis autoantibodies, nicotinic acetylcholine receptor confor...

    ID: 1796479

    Description: epitope description:E22, H23, E24, T25, R26, L27, V28, A29, K30, L31, F32, K33, D34, W80, V81, D82, Y83, N84, L85, K86, W87, N88, P89, D90, D91, Y92, ...

    Publication: 19890000;

  96. Mechanism of dinitrochlorobenzene-induced dermatitis in mice: role of specific antibodies in pathogenesis.

    ID: 1796481

    Description: epitope description:2,4-dinitrophenyl group host organism:Mus musculus BALB/c

    Publication: 19890385;

  97. Mechanism of dinitrochlorobenzene-induced dermatitis in mice: role of specific antibodies in pathogenesis.

    ID: 1796491

    Description: epitope description:2,4-dinitrophenyl group host organism:Mus musculus BALB/c

    Publication: 19890385;

  98. Characterization of a monoclonal antibody specific for lipoteichoic acid from various gram-positive bacteria.

    ID: 1796597

    Description: epitope description:glycerol 1-phosphate antigen name:lipoteichoic acid host organism:Mus musculus BALB/c antibody name:3G6

    Publication: 6083437;

  99. Identification of peptide mimetics of xenoreactive alpha-Gal antigenic epitope by phage display.

    ID: 1796601

    Description: epitope description:FHENWPS host organism:Mus musculus antibody name:anti-B

    Publication: 16630577;

  100. Mercaptobenzothiazole allergenicity-role of the thiol group.

    ID: 1796604

    Description: epitope description:dibenzothiazol-2-yl disulfide host organism:Cavia porcellus Hartley

    Publication: 18568896;
Displaying 100 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston