Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 100 of 1,510,353 results for " "

  1. The neuropathic potential of anti-GM1 autoantibodies is regulated by the local glycolipid environment in mice.

    ID: 1801352

    Description: epitope description:beta-D-Gal-(1->3)-beta-D-GalNAc-(1->4)-[alpha-Neu5Ac-(2->8)-alpha-Neu5Ac-(2->3)]-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer host or...

    Publication: 19221437;

  2. Stimulation of CD4+ T lymphocytes by allogeneic MHC peptides presented on autologous antigen-presenting cells. Evidence of the indirect pathway of all...

    ID: 1801355

    Description: epitope description:WERETRKARDTGRNFKVNLR antigen name:Other Major histocompatibility complex host organism:Rattus norvegicus Lewis

    Publication: 1348884;

  3. Protection against Escherichia coli-induced urinary tract infections with hybridoma antibodies directed against type 1 fimbriae or complementary D-man...

    ID: 1801366

    Description: epitope description:methyl alpha-D-mannoside host organism:Mus musculus antibody name:A07

    Publication: 2860067;

  4. Identification of linear HLA class II amino acid sequences recognized by rabbit antisera against native molecules.

    ID: 1801368

    Description: epitope description:SQKEVLERTRAELDTVC antigen name:HLA class II histocompatibility antigen, DQ beta 1 chain (UniProt:P01920) host organism:Oryctolagus...

    Publication: 2447636;

  5. Immunohistochemical detection of advanced glycosylation end products in diabetic tissues using monoclonal antibody to pyrraline.

    ID: 1801416

    Description: epitope description:pyrraline host organism:Mus musculus BALB/c antibody name:Pyr.B, Pyr.A

    Publication: 1556177;

  6. The formation of tau pathological phospho-epitopes in the axon is prevented by the dephosphorylation of selective sites in primary hippocampal neurons...

    ID: 1801429

    Description: epitope description:S396, S404 + PHOS(S396, S404) antigen name:Other Homo sapiens (human) protein host organism:Mus musculus antibody name:PHF-1

    Publication: 20550628;

  7. Analysis of anti-GM1 ganglioside IgM antibodies cloned from motor neuropathy patients demonstrates diverse V region gene usage with extensive somatic ...

    ID: 1801431

    Description: epitope description:alpha-N-acetylneuraminosyl-(2->3)-[beta-D-galactosyl-(1->3)-N-acetyl-beta-D-galactosaminyl-(1->4)]-beta-D-galactosyl-(1->4)-beta-D...

    Publication: 7673721;

  8. Analysis of anti-GM1 ganglioside IgM antibodies cloned from motor neuropathy patients demonstrates diverse V region gene usage with extensive somatic ...

    ID: 1801432

    Description: epitope description:alpha-N-acetylneuraminosyl-(2->3)-[beta-D-galactosyl-(1->3)-N-acetyl-beta-D-galactosaminyl-(1->4)]-beta-D-galactosyl-(1->4)-beta-D...

    Publication: 7673721;

  9. Analysis of anti-GM1 ganglioside IgM antibodies cloned from motor neuropathy patients demonstrates diverse V region gene usage with extensive somatic ...

    ID: 1801439

    Description: epitope description:beta-D-Gal-(1->3)-beta-D-GalNAc-(1->4)-[alpha-Neu5Ac-(2->8)-alpha-Neu5Ac-(2->3)]-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer host or...

    Publication: 7673721;

  10. Analysis of anti-GM1 ganglioside IgM antibodies cloned from motor neuropathy patients demonstrates diverse V region gene usage with extensive somatic ...

    ID: 1801441

    Description: epitope description:beta-D-Gal-(1->3)-beta-D-GalNAc-(1->4)-[alpha-Neu5Ac-(2->8)-alpha-Neu5Ac-(2->3)]-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer host or...

    Publication: 7673721;

  11. Analysis of anti-GM1 ganglioside IgM antibodies cloned from motor neuropathy patients demonstrates diverse V region gene usage with extensive somatic ...

    ID: 1801447

    Description: epitope description:beta-D-Gal-(1->3)-beta-D-GalNAc-(1->4)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer host organism:Homo sapiens antibody name:DO1

    Publication: 7673721;

  12. Analysis of anti-GM1 ganglioside IgM antibodies cloned from motor neuropathy patients demonstrates diverse V region gene usage with extensive somatic ...

    ID: 1801448

    Description: epitope description:beta-D-Gal-(1->3)-beta-D-GalNAc-(1->4)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer host organism:Homo sapiens antibody name:DO1

    Publication: 7673721;

  13. Immunohistochemical detection of advanced glycosylation end products in diabetic tissues using monoclonal antibody to pyrraline.

    ID: 1801451

    Description: epitope description:pyrraline host organism:Mus musculus BALB/c antibody name:Pyr.B, Pyr.A

    Publication: 1556177;

  14. A peptide based on the complementarity determining region 1 of a human monoclonal autoantibody ameliorates spontaneous and induced lupus manifestation...

    ID: 1801545

    Description: epitope description:GYYWSWIRQPPGKGEEWIG antigen name:Other Homo sapiens (human) protein host organism:Mus musculus BALB/c

    Publication: 15622442;

  15. Epitopes on proteinase-3 recognized by antibodies from patients with Wegener's granulomatosis.

    ID: 1801576

    Description: epitope description:ATVQLPQ antigen name:Myeloblastin host organism:Oryctolagus cuniculus

    Publication: 8157982;

  16. Epitopes on proteinase-3 recognized by antibodies from patients with Wegener's granulomatosis.

    ID: 1801604

    Description: epitope description:DWIRSTL antigen name:Myeloblastin host organism:Oryctolagus cuniculus

    Publication: 8157982;

  17. Epitopes on proteinase-3 recognized by antibodies from patients with Wegener's granulomatosis.

    ID: 1801612

    Description: epitope description:VRTQEPT antigen name:Myeloblastin host organism:Oryctolagus cuniculus

    Publication: 8157982;

  18. A major IgE epitope of rainbow trout collagen alpha2 chain.

    ID: 1801637

    Description: epitope description:MKGLRGHPGLQGMPGPSGPS antigen name:Type 1 collagen alpha 2 host organism:Homo sapiens

    Publication: 20827051;

  19. Epitopes on proteinase-3 recognized by antibodies from patients with Wegener's granulomatosis.

    ID: 1801650

    Description: epitope description:RVGAHDP antigen name:Myeloblastin host organism:Homo sapiens

    Publication: 8157982;

  20. Epitopes on proteinase-3 recognized by antibodies from patients with Wegener's granulomatosis.

    ID: 1801652

    Description: epitope description:TQEPTQQ antigen name:Myeloblastin host organism:Homo sapiens

    Publication: 8157982;

  21. Recognition of oxidized DNA bases by sera of patients with inflammatory diseases.

    ID: 1801667

    Description: epitope description:5-hydroxymethyl-2'-deoxyuridine host organism:Homo sapiens

    Publication: 8349138;

  22. Epitopes on proteinase-3 recognized by antibodies from patients with Wegener's granulomatosis.

    ID: 1801668

    Description: epitope description:ATVQLPQ antigen name:Myeloblastin host organism:Homo sapiens

    Publication: 8157982;

  23. Epitopes on proteinase-3 recognized by antibodies from patients with Wegener's granulomatosis.

    ID: 1801680

    Description: epitope description:RVGAHDP antigen name:Myeloblastin host organism:Homo sapiens

    Publication: 8157982;

  24. Epitopes on proteinase-3 recognized by antibodies from patients with Wegener's granulomatosis.

    ID: 1801682

    Description: epitope description:ATVQLPQ antigen name:Myeloblastin host organism:Homo sapiens

    Publication: 8157982;

  25. Epitopes on proteinase-3 recognized by antibodies from patients with Wegener's granulomatosis.

    ID: 1801686

    Description: epitope description:RVGAHDP antigen name:Myeloblastin host organism:Oryctolagus cuniculus

    Publication: 8157982;

  26. Allergenicity of Hev b 13, a major esterase allergen in natural rubber latex (Hevea brasiliensis) allergy, does not only depend on its carbohydrate mo...

    ID: 1801690

    Description: epitope description:MEFPETNNNPIITLS antigen name:Hev b 13 host organism:Homo sapiens

    Publication: 19945164;

  27. Allergenicity of Hev b 13, a major esterase allergen in natural rubber latex (Hevea brasiliensis) allergy, does not only depend on its carbohydrate mo...

    ID: 1801696

    Description: epitope description:DSNSDTGGKAAAFYP antigen name:Hev b 13 host organism:Homo sapiens

    Publication: 19945164;

  28. Allergenicity of Hev b 13, a major esterase allergen in natural rubber latex (Hevea brasiliensis) allergy, does not only depend on its carbohydrate mo...

    ID: 1801708

    Description: epitope description:TTIIPAHGGFSPFYL antigen name:Hev b 13 host organism:Homo sapiens

    Publication: 19945164;

  29. Allergenicity of Hev b 13, a major esterase allergen in natural rubber latex (Hevea brasiliensis) allergy, does not only depend on its carbohydrate mo...

    ID: 1801712

    Description: epitope description:FYLDVQYSQFRQFIP antigen name:Hev b 13 host organism:Homo sapiens

    Publication: 19945164;

  30. Allergenicity of Hev b 13, a major esterase allergen in natural rubber latex (Hevea brasiliensis) allergy, does not only depend on its carbohydrate mo...

    ID: 1801719

    Description: epitope description:ETGGIFAELVPEEYY antigen name:Hev b 13 host organism:Homo sapiens

    Publication: 19945164;

  31. Allergenicity of Hev b 13, a major esterase allergen in natural rubber latex (Hevea brasiliensis) allergy, does not only depend on its carbohydrate mo...

    ID: 1801720

    Description: epitope description:GIFAELVPEEYYFEK antigen name:Hev b 13 host organism:Homo sapiens

    Publication: 19945164;

  32. Allergenicity of Hev b 13, a major esterase allergen in natural rubber latex (Hevea brasiliensis) allergy, does not only depend on its carbohydrate mo...

    ID: 1801750

    Description: epitope description:TEGFLNLTVEEVNAT antigen name:Hev b 13 host organism:Homo sapiens

    Publication: 19945164;

  33. Allergenicity of Hev b 13, a major esterase allergen in natural rubber latex (Hevea brasiliensis) allergy, does not only depend on its carbohydrate mo...

    ID: 1801753

    Description: epitope description:KKIYDLGARTFWIHN antigen name:Hev b 13 host organism:Homo sapiens

    Publication: 19945164;

  34. Allergenicity of Hev b 13, a major esterase allergen in natural rubber latex (Hevea brasiliensis) allergy, does not only depend on its carbohydrate mo...

    ID: 1801756

    Description: epitope description:TFWIHNTGPIGCLSF antigen name:Hev b 13 host organism:Homo sapiens

    Publication: 19945164;

  35. Allergenicity of Hev b 13, a major esterase allergen in natural rubber latex (Hevea brasiliensis) allergy, does not only depend on its carbohydrate mo...

    ID: 1801766

    Description: epitope description:VAQLRKDLPLATFVH antigen name:Hev b 13 host organism:Homo sapiens

    Publication: 19945164;

  36. Allergenicity of Hev b 13, a major esterase allergen in natural rubber latex (Hevea brasiliensis) allergy, does not only depend on its carbohydrate mo...

    ID: 1801767

    Description: epitope description:LRKDLPLATFVHVDI antigen name:Hev b 13 host organism:Homo sapiens

    Publication: 19945164;

  37. Allergenicity of Hev b 13, a major esterase allergen in natural rubber latex (Hevea brasiliensis) allergy, does not only depend on its carbohydrate mo...

    ID: 1801768

    Description: epitope description:DLPLATFVHVDIYSV antigen name:Hev b 13 host organism:Homo sapiens

    Publication: 19945164;

  38. Allergenicity of Hev b 13, a major esterase allergen in natural rubber latex (Hevea brasiliensis) allergy, does not only depend on its carbohydrate mo...

    ID: 1801774

    Description: epitope description:FEFPLITCCGYGGKY antigen name:Hev b 13 host organism:Homo sapiens

    Publication: 19945164;

  39. Allergenicity of Hev b 13, a major esterase allergen in natural rubber latex (Hevea brasiliensis) allergy, does not only depend on its carbohydrate mo...

    ID: 1801778

    Description: epitope description:NFSVTAPCGDTVTAD antigen name:Hev b 13 host organism:Homo sapiens

    Publication: 19945164;

  40. Allergenicity of Hev b 13, a major esterase allergen in natural rubber latex (Hevea brasiliensis) allergy, does not only depend on its carbohydrate mo...

    ID: 1801781

    Description: epitope description:DTVTADDGTKIVVGS antigen name:Hev b 13 host organism:Homo sapiens

    Publication: 19945164;

  41. Allergenicity of Hev b 13, a major esterase allergen in natural rubber latex (Hevea brasiliensis) allergy, does not only depend on its carbohydrate mo...

    ID: 1801785

    Description: epitope description:VGSCACPSVRVNWDG antigen name:Hev b 13 host organism:Homo sapiens

    Publication: 19945164;

  42. Allergenicity of Hev b 13, a major esterase allergen in natural rubber latex (Hevea brasiliensis) allergy, does not only depend on its carbohydrate mo...

    ID: 1801787

    Description: epitope description:PSVRVNWDGAHYTEA antigen name:Hev b 13 host organism:Homo sapiens

    Publication: 19945164;

  43. Synthesis of an anthrose derivative and production of polyclonal antibodies for the detection of anthrax spores.

    ID: 1801807

    Description: epitope description:N-benzyloxycarbonylaminoethyl-4,6-dideoxy-4-(3-hydroxy-3-methylbutanamido)-2-O-methyl-beta-D-glucopyranoside antigen name:anthropy...

    Publication: 18155682;

  44. Synthesis of an anthrose derivative and production of polyclonal antibodies for the detection of anthrax spores.

    ID: 1801811

    Description: epitope description:1-O-(N-benzyloxycarbonylaminoethyl)-3-O-benzoyl-alpha-anthroside antigen name:anthropyranosyl-(1->3)-Rhap-(1->3)-Rhap-(1->2)-Rhap ...

    Publication: 18155682;

  45. The development of therapeutic antibodies that neutralize homologous and heterologous genotypes of dengue virus type 1.

    ID: 1801853

    Description: epitope description:V300, T303, K307, E309, G328, P332 antigen name:Genome polyprotein host organism:Mus musculus C57BL/6

    Publication: 20369024;

  46. Epitopes on proteinase-3 recognized by antibodies from patients with Wegener's granulomatosis.

    ID: 1801861

    Description: epitope description:RVGAHDP antigen name:Myeloblastin host organism:Oryctolagus cuniculus

    Publication: 8157982;

  47. Allergenicity of Hev b 13, a major esterase allergen in natural rubber latex (Hevea brasiliensis) allergy, does not only depend on its carbohydrate mo...

    ID: 1801869

    Description: epitope description:SANVKKIYDLGARTFWIHNTGPIGCLSFILTYFPWAEKD antigen name:Hev b 13 host organism:Homo sapiens

    Publication: 19945164;

  48. The development of therapeutic antibodies that neutralize homologous and heterologous genotypes of dengue virus type 1.

    ID: 1801874

    Description: epitope description:V300, T303, K307, E309, G328, P332 antigen name:Genome polyprotein host organism:Mus musculus C57BL/6 antibody name:E90

    Publication: 20369024;

  49. Allergenicity of Hev b 13, a major esterase allergen in natural rubber latex (Hevea brasiliensis) allergy, does not only depend on its carbohydrate mo...

    ID: 1801877

    Description: epitope description:PVPLNMACHKTESLRTLASV antigen name:Hev b 13 host organism:Homo sapiens

    Publication: 19945164;

  50. The development of therapeutic antibodies that neutralize homologous and heterologous genotypes of dengue virus type 1.

    ID: 1801881

    Description: epitope description:S390, W391 antigen name:Genome polyprotein host organism:Mus musculus C57BL/6 antibody name:E95, E112

    Publication: 20369024;

  51. The development of therapeutic antibodies that neutralize homologous and heterologous genotypes of dengue virus type 1.

    ID: 1801891

    Description: epitope description:S390, W391 antigen name:Genome polyprotein host organism:Mus musculus C57BL/6 antibody name:E95, E112

    Publication: 20369024;

  52. The development of therapeutic antibodies that neutralize homologous and heterologous genotypes of dengue virus type 1.

    ID: 1801893

    Description: epitope description:S390, W391 antigen name:Genome polyprotein host organism:Mus musculus C57BL/6 antibody name:E95, E112

    Publication: 20369024;

  53. The development of therapeutic antibodies that neutralize homologous and heterologous genotypes of dengue virus type 1.

    ID: 1801899

    Description: epitope description:M301, K310, E375, S390 antigen name:Genome polyprotein host organism:Mus musculus C57BL/6 antibody name:E98

    Publication: 20369024;

  54. The development of therapeutic antibodies that neutralize homologous and heterologous genotypes of dengue virus type 1.

    ID: 1801909

    Description: epitope description:M301, K310, E375, S390 antigen name:Genome polyprotein host organism:Mus musculus C57BL/6 antibody name:E98

    Publication: 20369024;

  55. The development of therapeutic antibodies that neutralize homologous and heterologous genotypes of dengue virus type 1.

    ID: 1801912

    Description: epitope description:M301, K310, E375, S390 antigen name:Genome polyprotein host organism:Mus musculus C57BL/6 antibody name:E98

    Publication: 20369024;

  56. The development of therapeutic antibodies that neutralize homologous and heterologous genotypes of dengue virus type 1.

    ID: 1801916

    Description: epitope description:K307, E309, K310, E311 antigen name:Genome polyprotein host organism:Mus musculus C57BL/6 antibody name:E99

    Publication: 20369024;

  57. The development of therapeutic antibodies that neutralize homologous and heterologous genotypes of dengue virus type 1.

    ID: 1801917

    Description: epitope description:K307, E309, K310, E311 antigen name:Genome polyprotein host organism:Mus musculus C57BL/6 antibody name:E99

    Publication: 20369024;

  58. The development of therapeutic antibodies that neutralize homologous and heterologous genotypes of dengue virus type 1.

    ID: 1801925

    Description: epitope description:K307, E309, K310, E311 antigen name:Genome polyprotein host organism:Mus musculus C57BL/6 antibody name:E99

    Publication: 20369024;

  59. The development of therapeutic antibodies that neutralize homologous and heterologous genotypes of dengue virus type 1.

    ID: 1801926

    Description: epitope description:K307, E309, K310, E311 antigen name:Genome polyprotein host organism:Mus musculus C57BL/6 antibody name:E99

    Publication: 20369024;

  60. The development of therapeutic antibodies that neutralize homologous and heterologous genotypes of dengue virus type 1.

    ID: 1801929

    Description: epitope description:K307, E309, K310, E311 antigen name:Genome polyprotein host organism:Mus musculus C57BL/6 antibody name:E99

    Publication: 20369024;

  61. The development of therapeutic antibodies that neutralize homologous and heterologous genotypes of dengue virus type 1.

    ID: 1801942

    Description: epitope description:V300, M301, K307, K310, V324, T329, D330, P332, K361, E362, E370, K393 antigen name:Genome polyprotein host organism:Mus musculus ...

    Publication: 20369024;

  62. The development of therapeutic antibodies that neutralize homologous and heterologous genotypes of dengue virus type 1.

    ID: 1801946

    Description: epitope description:V300, M301, K307, K310, V324, T329, D330, P332, K361, E362, E370, K393 antigen name:Genome polyprotein host organism:Mus musculus ...

    Publication: 20369024;

  63. The development of therapeutic antibodies that neutralize homologous and heterologous genotypes of dengue virus type 1.

    ID: 1801948

    Description: epitope description:V300, M301, K307, K310, V324, T329, D330, P332, K361, E362, E370, K393 antigen name:Genome polyprotein host organism:Mus musculus ...

    Publication: 20369024;

  64. The development of therapeutic antibodies that neutralize homologous and heterologous genotypes of dengue virus type 1.

    ID: 1801961

    Description: epitope description:T303, G328, T329, D330, P332 antigen name:Genome polyprotein host organism:Mus musculus C57BL/6 antibody name:E101, E103

    Publication: 20369024;

  65. The development of therapeutic antibodies that neutralize homologous and heterologous genotypes of dengue virus type 1.

    ID: 1801970

    Description: epitope description:Y299, V300, M301, V324, G328, D330, P332, K334 antigen name:Genome polyprotein host organism:Mus musculus C57BL/6 antibody name:E1...

    Publication: 20369024;

  66. The development of therapeutic antibodies that neutralize homologous and heterologous genotypes of dengue virus type 1.

    ID: 1801976

    Description: epitope description:Y299, V300, M301, V324, G328, D330, P332, K334 antigen name:Genome polyprotein host organism:Mus musculus C57BL/6 antibody name:E1...

    Publication: 20369024;

  67. The development of therapeutic antibodies that neutralize homologous and heterologous genotypes of dengue virus type 1.

    ID: 1801989

    Description: epitope description:E311, G328, D330, K361, E362, E375, K385, S390, W391 antigen name:Genome polyprotein host organism:Mus musculus C57BL/6 antibody n...

    Publication: 20369024;

  68. The development of therapeutic antibodies that neutralize homologous and heterologous genotypes of dengue virus type 1.

    ID: 1801999

    Description: epitope description:E311, G328, D330, K361, E362, E375, K385, S390, W391 antigen name:Genome polyprotein host organism:Mus musculus C57BL/6 antibody n...

    Publication: 20369024;

  69. The development of therapeutic antibodies that neutralize homologous and heterologous genotypes of dengue virus type 1.

    ID: 1802001

    Description: epitope description:E311, G328, D330, K361, E362, E375, K385, S390, W391 antigen name:Genome polyprotein host organism:Mus musculus C57BL/6 antibody n...

    Publication: 20369024;

  70. The development of therapeutic antibodies that neutralize homologous and heterologous genotypes of dengue virus type 1.

    ID: 1802002

    Description: epitope description:E311, G328, D330, K361, E362, E375, K385, S390, W391 antigen name:Genome polyprotein host organism:Mus musculus C57BL/6 antibody n...

    Publication: 20369024;

  71. The development of therapeutic antibodies that neutralize homologous and heterologous genotypes of dengue virus type 1.

    ID: 1802006

    Description: epitope description:K307, K310, V324, T329, D330, P332, Q340, K343, K361, E362, P364, S390 antigen name:Genome polyprotein host organism:Mus musculus ...

    Publication: 20369024;

  72. The development of therapeutic antibodies that neutralize homologous and heterologous genotypes of dengue virus type 1.

    ID: 1802007

    Description: epitope description:K307, K310, V324, T329, D330, P332, Q340, K343, K361, E362, P364, S390 antigen name:Genome polyprotein host organism:Mus musculus ...

    Publication: 20369024;

  73. The development of therapeutic antibodies that neutralize homologous and heterologous genotypes of dengue virus type 1.

    ID: 1802015

    Description: epitope description:K307, K310, V324, T329, D330, P332, Q340, K343, K361, E362, P364, S390 antigen name:Genome polyprotein host organism:Mus musculus ...

    Publication: 20369024;

  74. The development of therapeutic antibodies that neutralize homologous and heterologous genotypes of dengue virus type 1.

    ID: 1802018

    Description: epitope description:K307, K310, V324, T329, D330, P332, Q340, K343, K361, E362, P364, S390 antigen name:Genome polyprotein host organism:Mus musculus ...

    Publication: 20369024;

  75. The development of therapeutic antibodies that neutralize homologous and heterologous genotypes of dengue virus type 1.

    ID: 1802026

    Description: epitope description:K310, G328, T329, D330, P332, K361, E362, P364, E384, K385 antigen name:Genome polyprotein host organism:Mus musculus C57BL/6 anti...

    Publication: 20369024;

  76. The development of therapeutic antibodies that neutralize homologous and heterologous genotypes of dengue virus type 1.

    ID: 1802032

    Description: epitope description:K310, G328, T329, D330, P332, K361, E362, P364, E384, K385 antigen name:Genome polyprotein host organism:Mus musculus C57BL/6 anti...

    Publication: 20369024;

  77. The development of therapeutic antibodies that neutralize homologous and heterologous genotypes of dengue virus type 1.

    ID: 1802034

    Description: epitope description:K310, G328, T329, D330, P332, K361, E362, P364, E384, K385 antigen name:Genome polyprotein host organism:Mus musculus C57BL/6 anti...

    Publication: 20369024;

  78. The development of therapeutic antibodies that neutralize homologous and heterologous genotypes of dengue virus type 1.

    ID: 1802035

    Description: epitope description:K310, G328, T329, D330, P332, K361, E362, P364, E384, K385 antigen name:Genome polyprotein host organism:Mus musculus C57BL/6 anti...

    Publication: 20369024;

  79. Immunity in the connective tissue diseases. The humoral side of the coin.

    ID: 1799816

    Description: epitope description:PREPQVY antigen name:Immunoglobulin host organism:Homo sapiens

    Publication: 8774549;

  80. Antigen specific quantification of sulfidoleukotrienes in patients allergic to Betalactam antibiotics.

    ID: 1799822

    Description: epitope description:amoxicillin host organism:Homo sapiens

    Publication: 15864881;

  81. Antigen specific quantification of sulfidoleukotrienes in patients allergic to Betalactam antibiotics.

    ID: 1799834

    Description: epitope description:benzylpenicillin host organism:Homo sapiens

    Publication: 15864881;

  82. Immunity in the connective tissue diseases. The humoral side of the coin.

    ID: 1799850

    Description: epitope description:QPREPQV antigen name:Immunoglobulin host organism:Homo sapiens antibody name:H6

    Publication: 8774549;

  83. Immunity in the connective tissue diseases. The humoral side of the coin.

    ID: 1799856

    Description: epitope description:VYTLPPS antigen name:Immunoglobulin host organism:Homo sapiens antibody name:H6

    Publication: 8774549;

  84. Immunity in the connective tissue diseases. The humoral side of the coin.

    ID: 1799866

    Description: epitope description:MHEALHN antigen name:Immunoglobulin host organism:Homo sapiens antibody name:H6

    Publication: 8774549;

  85. Immunity in the connective tissue diseases. The humoral side of the coin.

    ID: 1799871

    Description: epitope description:PPPGIRGP antigen name:Small nuclear ribonucleoprotein-associated protein N host organism:Homo sapiens

    Publication: 8774549;

  86. The immunodominant epitope of centromere-associated protein A displays homology with the transcription factor forkhead box E3 (FOXE3).

    ID: 1799914

    Description: epitope description:PTPETGPLQR antigen name:Condensin-2 complex subunit D3 host organism:Mus musculus BALB/c

    Publication: 20630806;

  87. Immunogenicity of polysaccharides conjugated to peptides containing T- and B-cell epitopes.

    ID: 1800674

    Description: epitope description:TPEDPTDPTDPQDPSS antigen name:UniProt:I6TX52 host organism:Rattus norvegicus Wistar

    Publication: 7509317;

  88. Thermodynamic investigation of monoclonal antibody alkylated nucleoside interaction as a model for epitope recognition on nucleic acids.

    ID: 1800694

    Description: epitope description:O(6)-methyl-2'-deoxyguanosine host organism:Mus musculus BALB/c antibody name:EM-1

    Publication: 2441745;

  89. Protection against Escherichia coli-induced urinary tract infections with hybridoma antibodies directed against type 1 fimbriae or complementary D-man...

    ID: 1800695

    Description: epitope description:D-mannose host organism:Mus musculus antibody name:A07

    Publication: 2860067;

  90. Protection against Escherichia coli-induced urinary tract infections with hybridoma antibodies directed against type 1 fimbriae or complementary D-man...

    ID: 1800705

    Description: epitope description:D-mannose host organism:Mus musculus

    Publication: 2860067;

  91. Protection against Escherichia coli-induced urinary tract infections with hybridoma antibodies directed against type 1 fimbriae or complementary D-man...

    ID: 1800708

    Description: epitope description:N-acetyl-D-galactosamine host organism:Mus musculus antibody name:F12

    Publication: 2860067;

  92. Protection against Escherichia coli-induced urinary tract infections with hybridoma antibodies directed against type 1 fimbriae or complementary D-man...

    ID: 1800710

    Description: epitope description:N-acetyl-D-galactosamine host organism:Mus musculus antibody name:F12

    Publication: 2860067;

  93. Protection against Escherichia coli-induced urinary tract infections with hybridoma antibodies directed against type 1 fimbriae or complementary D-man...

    ID: 1800711

    Description: epitope description:N-acetyl-D-galactosamine host organism:Mus musculus

    Publication: 2860067;

  94. Prevalence and clinical significance of antiphospholipid antibodies to noncardiolipin antigens in systemic lupus erythematosus.

    ID: 1800727

    Description: epitope description:phosphatidylcholine(1+) host organism:Homo sapiens

    Publication: 8175049;

  95. Prevalence and clinical significance of antiphospholipid antibodies to noncardiolipin antigens in systemic lupus erythematosus.

    ID: 1800730

    Description: epitope description:phosphatidylethanolamine host organism:Homo sapiens

    Publication: 8175049;

  96. Prevalence and clinical significance of antiphospholipid antibodies to noncardiolipin antigens in systemic lupus erythematosus.

    ID: 1800731

    Description: epitope description:phosphatidylethanolamine host organism:Homo sapiens

    Publication: 8175049;

  97. Prevalence and clinical significance of antiphospholipid antibodies to noncardiolipin antigens in systemic lupus erythematosus.

    ID: 1800732

    Description: epitope description:phosphatidylinositol host organism:Homo sapiens

    Publication: 8175049;

  98. Prevalence and clinical significance of antiphospholipid antibodies to noncardiolipin antigens in systemic lupus erythematosus.

    ID: 1800735

    Description: epitope description:phosphatidylglycerol host organism:Homo sapiens

    Publication: 8175049;

  99. Prevalence and clinical significance of antiphospholipid antibodies to noncardiolipin antigens in systemic lupus erythematosus.

    ID: 1800737

    Description: epitope description:phosphatidylglycerol host organism:Homo sapiens

    Publication: 8175049;

  100. Prevalence and clinical significance of antiphospholipid antibodies to noncardiolipin antigens in systemic lupus erythematosus.

    ID: 1800738

    Description: epitope description:phosphatidic acid host organism:Homo sapiens

    Publication: 8175049;
Displaying 100 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston