Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 20 of 1,510,353 results for " "

  1. Use of synthetic peptides to map antigenic sites of Bordetella pertussis toxin subunit S1.

    ID: 1495061

    Description: epitope description:LEHRMQEAVEAERAGRGTGHFI antigen name:Pertussis toxin subunit 1 host organism:Homo sapiens

    Publication: 2450153;

  2. Generation and characterization of single-chain antibody fragments specific against transmembrane envelope glycoprotein gp46 of maedi-visna virus.

    ID: 1495095

    Description: epitope description:QELDCWHYQHYCVTSTKS antigen name:envelope polyprotein host organism:Mus musculus antibody name:B12, C12

    Publication: 14656464;

  3. Immunochemical analysis of Pseudomonas aeruginosa exotoxin A. Analysis of the His426 determinant.

    ID: 1495139

    Description: epitope description:LLQAHRQLEER antigen name:Exotoxin A host organism:Mus musculus NMRI antibody name:TC-1

    Publication: 1705936;

  4. Immunochemical analysis of Pseudomonas aeruginosa exotoxin A. Analysis of the His426 determinant.

    ID: 1495140

    Description: epitope description:LLQAHRQLEER antigen name:Exotoxin A host organism:Mus musculus NMRI antibody name:TC-1

    Publication: 1705936;

  5. Characterization of conserved T- and B-cell epitopes in Plasmodium falciparum major merozoite surface protein 1.

    ID: 1495164

    Description: epitope description:VTHESYQELVKKLEALEDAV antigen name:Merozoite surface protein 1 host organism:Mus musculus BALB/c

    Publication: 10768960;

  6. Antibody responses to defined regions of the Bordetella pertussis virulence factor pertactin.

    ID: 1495165

    Description: epitope description:GGAVPGGAVPGGAVPGGFGPGGFGP antigen name:Pertactin autotransporter host organism:Oryctolagus cuniculus New Zealand White antibody na...

    Publication: 17926203;

  7. Characterization of conserved T- and B-cell epitopes in Plasmodium falciparum major merozoite surface protein 1.

    ID: 1495166

    Description: epitope description:VTHESYQELVKKLEALEDAV antigen name:Merozoite surface protein 1 host organism:Mus musculus BALB/c

    Publication: 10768960;

  8. Antibody responses to defined regions of the Bordetella pertussis virulence factor pertactin.

    ID: 1495170

    Description: epitope description:GGAVPGGAVPGGFGPGGFGPGGFGPGGFGP antigen name:Pertactin autotransporter host organism:Oryctolagus cuniculus New Zealand White antibo...

    Publication: 17926203;

  9. Antibody responses to defined regions of the Bordetella pertussis virulence factor pertactin.

    ID: 1495182

    Description: epitope description:PQPGPQPPQPPQPQPEAPAPQPPAG antigen name:Pertactin autotransporter host organism:Oryctolagus cuniculus New Zealand White antibody na...

    Publication: 17926203;

  10. Antibodies to a synthetic peptide from the preS 120-145 region of the hepatitis B virus envelope are virus neutralizing.

    ID: 1495188

    Description: epitope description:MGGWSSKPRKGMGTNLSVPNP antigen name:Large envelope protein host organism:Homo sapiens

    Publication: 2421497;

  11. Antibodies to a synthetic peptide from the preS 120-145 region of the hepatitis B virus envelope are virus neutralizing.

    ID: 1495190

    Description: epitope description:MGTNLSVPNPLGFFPDHQLDP antigen name:Large envelope protein host organism:Homo sapiens

    Publication: 2421497;

  12. Conserved and nonconserved epitopes among Haemophilus influenzae type b pili.

    ID: 1495253

    Description: epitope description:ETSGKVTFFGKVV antigen name:HafA major pilin protein host organism:Oryctolagus cuniculus antibody name:R13

    Publication: 1694821;

  13. Deduced amino acid sequences of class 1 protein (PorA) from three strains of Neisseria meningitidis. Synthetic peptides define the epitopes responsibl...

    ID: 1495353

    Description: epitope description:TKDTNNNLTL antigen name:Major outer membrane protein P.IA host organism:Mus musculus BALB/c antibody name:MN5C11G, 62-D12

    Publication: 1693651;

  14. Analysis of human IgE epitope of Der f 2 with anti-Der f 2 mouse monoclonal antibodies.

    ID: 1495358

    Description: epitope description:D80, N82, H85, C84, C89 antigen name:Der f 2 host organism:Mus musculus BALB/c antibody name:mAb 15E11

    Publication: 10369420;

  15. Establishment of a monoclonal antibody recognizing an antigenic site common to Clostridium botulinum type B, C1, D, and E toxins and tetanus toxin.

    ID: 1495381

    Description: epitope description:PKINSFNYNDPVNDRTILYIKPGGCQEFYKSFNIMKNIWIIPERNVIGTTPQDFHPPTSLKNGDSSYYDPNYLQSDEEKDRFLKIVTKIFNRINNNLSGGILLEELSKANPYLGNDNTPDNQFHIGDASA...

    Publication: 2450068;

  16. Analysis of human IgE epitope of Der f 2 with anti-Der f 2 mouse monoclonal antibodies.

    ID: 1495460

    Description: epitope description:C84, F86, C89, P90 antigen name:Der f 2 host organism:Mus musculus BALB/c antibody name:mAb 18G8

    Publication: 10369420;

  17. Polymorphism of the major surface epitope of the CopB outer membrane protein of Moraxella catarrhalis.

    ID: 1495477

    Description: epitope description:NKYAGKGY antigen name:Outer membrane protein CopB host organism:Mus musculus antibody name:10F3

    Publication: 16872370;

  18. Cross-reactivity studies of an anti-Plasmodium vivax apical membrane antigen 1 monoclonal antibody: binding and structural characterisation.

    ID: 1495509

    Description: epitope description:K385, E386, C390, P391, C392, E393, P394, E395, N408, C409, V410 antigen name:Apical merozoite antigen 1 host organism:Mus musculu...

    Publication: 17229439;

  19. Non-immunized natural human heavy chain CDR3 repertoires allow the isolation of high affinity peptides mimicking a human influenza hemagglutinin epito...

    ID: 1495552

    Description: epitope description:YPYDVPDYA antigen name:Hemagglutinin host organism:Mus musculus antibody name:17/9

    Publication: 17936360;

  20. Non-immunized natural human heavy chain CDR3 repertoires allow the isolation of high affinity peptides mimicking a human influenza hemagglutinin epito...

    ID: 1495563

    Description: epitope description:SPAPERRGYSGYDVPDY antigen name:Other Homo sapiens (human) protein host organism:Mus musculus antibody name:17/9

    Publication: 17936360;
Displaying 20 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston