Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Synthetic peptides approach to identification of epitopes on bovine leukemia virus envelope glycoprotein gp51.

    ID: 1466976

    Description: epitope description:KFSISIDQ antigen name:gp60 SU host organism:Oryctolagus cuniculus antibody name:Anti-epitope rabbit sera

    Publication: 2466371;

  2. Synthetic peptides approach to identification of epitopes on bovine leukemia virus envelope glycoprotein gp51.

    ID: 1466982

    Description: epitope description:CPRSPRYTLD antigen name:gp60 SU host organism:Oryctolagus cuniculus antibody name:Anti-epitope rabbit sera

    Publication: 2466371;

  3. Synthetic peptides approach to identification of epitopes on bovine leukemia virus envelope glycoprotein gp51.

    ID: 1466987

    Description: epitope description:CPRSPRYTLD antigen name:gp60 SU host organism:Oryctolagus cuniculus antibody name:Anti-epitope rabbit sera

    Publication: 2466371;

  4. Synthetic peptides approach to identification of epitopes on bovine leukemia virus envelope glycoprotein gp51.

    ID: 1467001

    Description: epitope description:PPPQGRRRFGA antigen name:gp60 SU host organism:Oryctolagus cuniculus antibody name:Anti-epitope rabbit sera

    Publication: 2466371;

  5. Synthetic peptides approach to identification of epitopes on bovine leukemia virus envelope glycoprotein gp51.

    ID: 1467003

    Description: epitope description:PPPQGRRRFGA antigen name:gp60 SU host organism:Oryctolagus cuniculus antibody name:Anti-epitope rabbit sera

    Publication: 2466371;

  6. Synthetic peptides approach to identification of epitopes on bovine leukemia virus envelope glycoprotein gp51.

    ID: 1467022

    Description: epitope description:PDPPQPDFPQLN antigen name:gp60 SU host organism:Oryctolagus cuniculus antibody name:Anti-epitope rabbit sera

    Publication: 2466371;

  7. Synthetic peptides approach to identification of epitopes on bovine leukemia virus envelope glycoprotein gp51.

    ID: 1467023

    Description: epitope description:PDPPQPDFPQLN antigen name:gp60 SU host organism:Oryctolagus cuniculus antibody name:Anti-epitope rabbit sera

    Publication: 2466371;

  8. Synthetic peptides approach to identification of epitopes on bovine leukemia virus envelope glycoprotein gp51.

    ID: 1467025

    Description: epitope description:PDPPQPDFPQLNSD antigen name:gp60 SU host organism:Oryctolagus cuniculus antibody name:Anti-epitope rabbit sera

    Publication: 2466371;

  9. Synthetic peptides approach to identification of epitopes on bovine leukemia virus envelope glycoprotein gp51.

    ID: 1467026

    Description: epitope description:PDPPQPDFPQLNSD antigen name:gp60 SU host organism:Oryctolagus cuniculus antibody name:Anti-epitope rabbit sera

    Publication: 2466371;

  10. Synthetic peptides approach to identification of epitopes on bovine leukemia virus envelope glycoprotein gp51.

    ID: 1467032

    Description: epitope description:VYNKTISGSGP antigen name:gp60 SU host organism:Oryctolagus cuniculus antibody name:Anti-epitope rabbit sera

    Publication: 2466371;

  11. Synthetic peptides approach to identification of epitopes on bovine leukemia virus envelope glycoprotein gp51.

    ID: 1467041

    Description: epitope description:STVSSAPPTRVRR antigen name:gp60 SU host organism:Oryctolagus cuniculus antibody name:Anti-epitope rabbit sera

    Publication: 2466371;

  12. Synthetic peptides approach to identification of epitopes on bovine leukemia virus envelope glycoprotein gp51.

    ID: 1467045

    Description: epitope description:SAPPTRVRR antigen name:gp60 SU host organism:Oryctolagus cuniculus antibody name:Anti-epitope rabbit sera

    Publication: 2466371;

  13. Intranasal tolerance induction with polypeptides derived from 3 noncross-reactive major aeroallergens prevents allergic polysensitization in mice.

    ID: 1467259

    Description: epitope description:SKEMGETLLRAVESYLLAHSD antigen name:Bet v 1 host organism:Mus musculus BALB/c

    Publication: 16083792;

  14. Antibody responses to the env epitopes of human T-lymphotropic virus type I in rhesus macaques' naturally infected with simian T-lymphotropic virus ty...

    ID: 1467260

    Description: epitope description:SLLVDAPGYDPIWFLNTEPSQLPPTAPPLLPHSNLDHILEPSIPWKSK antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 8395074;

  15. Antibody responses to the env epitopes of human T-lymphotropic virus type I in rhesus macaques' naturally infected with simian T-lymphotropic virus ty...

    ID: 1467265

    Description: epitope description:SPNVSVPSSSSTPLLY antigen name:Envelope glycoprotein gp62 host organism:Macaca mulatta

    Publication: 8395074;

  16. Synthetic peptides approach to identification of epitopes on bovine leukemia virus envelope glycoprotein gp51.

    ID: 1467268

    Description: epitope description:YWPPPQGRRRF antigen name:gp60 SU host organism:Mus musculus antibody name:mAb 14F10

    Publication: 2466371;

  17. Humoral and cell-mediated immune responses in humans to the NSP4 enterotoxin of rotavirus.

    ID: 1467295

    Description: epitope description:DKLTTREIEQVELLKRIYDKL antigen name:Non-structural glycoprotein 4 host organism:Homo sapiens

    Publication: 10502271;

  18. Mapping of B-neutralizing and T-helper cell epitopes on the bovine leukemia virus external glycoprotein gp51.

    ID: 1467305

    Description: epitope description:KIPDPPQPDFPQLNSDWVPS antigen name:gp60 SU host organism:Oryctolagus cuniculus

    Publication: 7688821;

  19. Mapping of B-neutralizing and T-helper cell epitopes on the bovine leukemia virus external glycoprotein gp51.

    ID: 1467370

    Description: epitope description:GARAMVTYDCEPRCPYVGAD antigen name:gp60 SU host organism:Oryctolagus cuniculus

    Publication: 7688821;

  20. Mapping of B-neutralizing and T-helper cell epitopes on the bovine leukemia virus external glycoprotein gp51.

    ID: 1467374

    Description: epitope description:LNQTARAFPDCAICWEPSPP antigen name:gp60 SU host organism:Oryctolagus cuniculus

    Publication: 7688821;

  21. Mapping of B-neutralizing and T-helper cell epitopes on the bovine leukemia virus external glycoprotein gp51.

    ID: 1467382

    Description: epitope description:PYVGADRFDC antigen name:gp60 SU host organism:Oryctolagus cuniculus

    Publication: 7688821;

  22. Mapping of B-neutralizing and T-helper cell epitopes on the bovine leukemia virus external glycoprotein gp51.

    ID: 1467383

    Description: epitope description:VGADRFDCPHWDNASQADQG antigen name:gp60 SU host organism:Oryctolagus cuniculus

    Publication: 7688821;

  23. Mapping of B-neutralizing and T-helper cell epitopes on the bovine leukemia virus external glycoprotein gp51.

    ID: 1467386

    Description: epitope description:TLTWEIWGYDPLITFSLHKI antigen name:gp60 SU host organism:Oryctolagus cuniculus

    Publication: 7688821;

  24. Induction of feline immunodeficiency virus-specific cell-mediated and humoral immune responses following immunization with a multiple antigenic peptid...

    ID: 1467499

    Description: epitope description:RAISSWKQRNRWEWRPD antigen name:envelope polyprotein host organism:Felis catus

    Publication: 7543872;

  25. Induction of feline immunodeficiency virus-specific cell-mediated and humoral immune responses following immunization with a multiple antigenic peptid...

    ID: 1467532

    Description: epitope description:SWKQRNRWEW antigen name:envelope polyprotein host organism:Felis catus

    Publication: 7543872;

  26. Roles of major oligosaccharides on Cry j 1 in human immunoglobulin E and T cell responses.

    ID: 1467674

    Description: epitope description:alpha-D-Man-(1->6)-[alpha-D-Man-(1->3)]-[beta-D-Xyl-(1->2)]-beta-D-Man-(1->4)-beta-D-GlcNAc-(1->4)-[alpha-L-Fuc-(1->3)]-beta-D-Glc...

    Publication: 15144470;

  27. Roles of major oligosaccharides on Cry j 1 in human immunoglobulin E and T cell responses.

    ID: 1467676

    Description: epitope description:alpha-D-Man-(1->2)-alpha-D-Man-(1->2)-alpha-D-Man-(1->3)-[alpha-D-Man-(1->2)-alpha-D-Man-(1->3)-[alpha-D-Man-(1->2)-alpha-D-Man-(1...

    Publication: 15144470;

  28. Trypanosoma cruzi: cellular and antibody response against the parasite in mice immunized with a 19-amino acid synthetic peptide.

    ID: 1467730

    Description: epitope description:PAFLGCSSRFSGSFSGVEP host organism:Mus musculus BALB/c antibody name:Anti-SP4 sera

    Publication: 1993465;

  29. Specificity analysis of anti-gliadin mouse monoclonal antibodies used for detection of gliadin in food for gluten-free diet.

    ID: 1467732

    Description: epitope description:QFQGQQQPFP antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Mus musculus BALB/c antibody na...

    Publication: 17335223;

  30. Specificity analysis of anti-gliadin mouse monoclonal antibodies used for detection of gliadin in food for gluten-free diet.

    ID: 1467749

    Description: epitope description:QQQPFPPQQP antigen name:Tri a 21 host organism:Mus musculus BALB/c antibody name:6H5, 8D4, 7C6

    Publication: 17335223;

  31. Specificity analysis of anti-gliadin mouse monoclonal antibodies used for detection of gliadin in food for gluten-free diet.

    ID: 1467750

    Description: epitope description:YPQPQPFPSQ antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Mus musculus BALB/c antibody na...

    Publication: 17335223;

  32. Specificity analysis of anti-gliadin mouse monoclonal antibodies used for detection of gliadin in food for gluten-free diet.

    ID: 1467751

    Description: epitope description:YPQPQPFPSQ antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Mus musculus BALB/c antibody na...

    Publication: 17335223;

  33. Specificity analysis of anti-gliadin mouse monoclonal antibodies used for detection of gliadin in food for gluten-free diet.

    ID: 1467756

    Description: epitope description:QPQPFPPQLP antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Mus musculus BALB/c antibody na...

    Publication: 17335223;

  34. Specificity analysis of anti-gliadin mouse monoclonal antibodies used for detection of gliadin in food for gluten-free diet.

    ID: 1467761

    Description: epitope description:QPQPFRPQQP antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Mus musculus BALB/c antibody na...

    Publication: 17335223;

  35. Specificity analysis of anti-gliadin mouse monoclonal antibodies used for detection of gliadin in food for gluten-free diet.

    ID: 1467763

    Description: epitope description:QPFRPQQPYP antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Mus musculus BALB/c antibody na...

    Publication: 17335223;

  36. Specificity analysis of anti-gliadin mouse monoclonal antibodies used for detection of gliadin in food for gluten-free diet.

    ID: 1467803

    Description: epitope description:QQPFPQPQQP antigen name:Uncharacterized protein (UniProt:D2KFG9) host organism:Mus musculus BALB/c antibody name:5C7, 8D4

    Publication: 17335223;

  37. Specificity analysis of anti-gliadin mouse monoclonal antibodies used for detection of gliadin in food for gluten-free diet.

    ID: 1467812

    Description: epitope description:HHQPQQTFPQ antigen name:Uncharacterized protein (UniProt:D2KFG9) host organism:Mus musculus BALB/c antibody name:5C7, 6H5, 8D4

    Publication: 17335223;

  38. Specificity analysis of anti-gliadin mouse monoclonal antibodies used for detection of gliadin in food for gluten-free diet.

    ID: 1467815

    Description: epitope description:QQTFPQPQQT antigen name:Uncharacterized protein (UniProt:D2KFG9) host organism:Mus musculus BALB/c antibody name:5C7, 6H5, 8D4

    Publication: 17335223;

  39. Specificity analysis of anti-gliadin mouse monoclonal antibodies used for detection of gliadin in food for gluten-free diet.

    ID: 1467820

    Description: epitope description:YPHQPQQQFP antigen name:Uncharacterized protein (UniProt:D2KFG9) host organism:Mus musculus BALB/c antibody name:5C7, 6H5, 8D4

    Publication: 17335223;

  40. Specificity analysis of anti-gliadin mouse monoclonal antibodies used for detection of gliadin in food for gluten-free diet.

    ID: 1467828

    Description: epitope description:QPFPQPQQTF antigen name:Uncharacterized protein (UniProt:D2KFG9) host organism:Mus musculus BALB/c antibody name:6H5

    Publication: 17335223;

  41. Specificity analysis of anti-gliadin mouse monoclonal antibodies used for detection of gliadin in food for gluten-free diet.

    ID: 1467830

    Description: epitope description:FPQPQQTFPQ antigen name:Uncharacterized protein (UniProt:D2KFG9) host organism:Mus musculus BALB/c antibody name:5C7, 6H5, 8D4

    Publication: 17335223;

  42. Specificity analysis of anti-gliadin mouse monoclonal antibodies used for detection of gliadin in food for gluten-free diet.

    ID: 1467837

    Description: epitope description:QLPFPQQPQQ antigen name:Uncharacterized protein (UniProt:D2KFG9) host organism:Mus musculus BALB/c antibody name:8D4

    Publication: 17335223;

  43. Specificity analysis of anti-gliadin mouse monoclonal antibodies used for detection of gliadin in food for gluten-free diet.

    ID: 1467838

    Description: epitope description:QLPFPQQPQQ antigen name:Uncharacterized protein (UniProt:D2KFG9) host organism:Mus musculus BALB/c antibody name:8D4

    Publication: 17335223;

  44. Specificity analysis of anti-gliadin mouse monoclonal antibodies used for detection of gliadin in food for gluten-free diet.

    ID: 1467841

    Description: epitope description:QPQQPFPQPQ antigen name:Uncharacterized protein (UniProt:D2KFG9) host organism:Mus musculus BALB/c antibody name:5C7, 8D4

    Publication: 17335223;

  45. Specificity analysis of anti-gliadin mouse monoclonal antibodies used for detection of gliadin in food for gluten-free diet.

    ID: 1467843

    Description: epitope description:QQPFPQPQQP antigen name:Uncharacterized protein (UniProt:D2KFG9) host organism:Mus musculus BALB/c antibody name:5C7, 8D4

    Publication: 17335223;

  46. Specificity analysis of anti-gliadin mouse monoclonal antibodies used for detection of gliadin in food for gluten-free diet.

    ID: 1467849

    Description: epitope description:QQPFPQSQQP antigen name:Uncharacterized protein (UniProt:D2KFG9) host organism:Mus musculus BALB/c antibody name:5C7, 8D4

    Publication: 17335223;

  47. Specificity analysis of anti-gliadin mouse monoclonal antibodies used for detection of gliadin in food for gluten-free diet.

    ID: 1467860

    Description: epitope description:PQPQQQFPQP antigen name:Uncharacterized protein (UniProt:D2KFG9) host organism:Mus musculus BALB/c antibody name:5C7, 6H5, 8D4

    Publication: 17335223;

  48. Specificity analysis of anti-gliadin mouse monoclonal antibodies used for detection of gliadin in food for gluten-free diet.

    ID: 1467861

    Description: epitope description:PQQQFPQPQQ antigen name:Uncharacterized protein (UniProt:D2KFG9) host organism:Mus musculus BALB/c antibody name:5C7, 6H5, 8D4

    Publication: 17335223;

  49. Specificity analysis of anti-gliadin mouse monoclonal antibodies used for detection of gliadin in food for gluten-free diet.

    ID: 1467866

    Description: epitope description:QPQQPQQSFP antigen name:Uncharacterized protein (UniProt:D2KFG9) host organism:Mus musculus BALB/c antibody name:5C7, 6H5, 8D4

    Publication: 17335223;

  50. Specificity analysis of anti-gliadin mouse monoclonal antibodies used for detection of gliadin in food for gluten-free diet.

    ID: 1467867

    Description: epitope description:QQPQQSFPQQ antigen name:Uncharacterized protein (UniProt:D2KFG9) host organism:Mus musculus BALB/c antibody name:5C7, 6H5, 8D4

    Publication: 17335223;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston