Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 100 of 1,510,353 results for " "

  1. Taenia saginata derived synthetic peptides with potential for the diagnosis of bovine cysticercosis.

    ID: 1809605

    Description: epitope description:GGTEESVVTASRS antigen name:Other Taenia saginata (beef tapeworm) protein host organism:Bos taurus

    Publication: 12523981;

  2. Taenia saginata derived synthetic peptides with potential for the diagnosis of bovine cysticercosis.

    ID: 1809610

    Description: epitope description:RDPSKMRDIDRHHEYNVREGND antigen name:Myosin-like protein host organism:Bos taurus

    Publication: 12523981;

  3. Taenia saginata derived synthetic peptides with potential for the diagnosis of bovine cysticercosis.

    ID: 1809612

    Description: epitope description:RDPSKMRDIDRHHEYNVREGND antigen name:Myosin-like protein host organism:Bos taurus

    Publication: 12523981;

  4. Taenia saginata derived synthetic peptides with potential for the diagnosis of bovine cysticercosis.

    ID: 1809616

    Description: epitope description:RDPSKMRDIDRHHEYNVREGND antigen name:Myosin-like protein host organism:Bos taurus

    Publication: 12523981;

  5. Identification and characterization of gangliosides reacting with IgM paraproteins in three patients with neuropathy associated with biclonal gammopat...

    ID: 1809624

    Description: epitope description:beta-D-GlcA3S-(1->3)-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->3)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer host organism:Homo sapiens

    Publication: 2457654;

  6. Pulmonary hypertension in MCTD: report of two cases with anticardiolipin antibody.

    ID: 1809653

    Description: epitope description:cardiolipin host organism:Homo sapiens

    Publication: 1617892;

  7. Induction of antibodies to hyaluronic acid by immunization of rabbits with encapsulated streptococci.

    ID: 1809654

    Description: epitope description:glucuronic acid antigen name:hyaluronic acid host organism:Oryctolagus cuniculus

    Publication: 2427634;

  8. Protection of pig kidney (PK15) cells from the cytotoxic effect of anti-pig antibodies by alpha-galactosyl oligosaccharides.

    ID: 1809685

    Description: epitope description:alpha-D-Galp-(1->3)-beta-D-Galp-(1->4)-alpha-D-Galp-(1->3)-D-Galp host organism:Homo sapiens

    Publication: 8154046;

  9. Protection of pig kidney (PK15) cells from the cytotoxic effect of anti-pig antibodies by alpha-galactosyl oligosaccharides.

    ID: 1809698

    Description: epitope description:alpha-D-Gal-(1->3)-beta-D-Gal-(1->4)-D-Glc host organism:Homo sapiens

    Publication: 8154046;

  10. Protection of pig kidney (PK15) cells from the cytotoxic effect of anti-pig antibodies by alpha-galactosyl oligosaccharides.

    ID: 1809700

    Description: epitope description:galactan host organism:Homo sapiens

    Publication: 8154046;

  11. Protection of pig kidney (PK15) cells from the cytotoxic effect of anti-pig antibodies by alpha-galactosyl oligosaccharides.

    ID: 1809701

    Description: epitope description:penta-O-acetyl-alpha-D-galactose host organism:Homo sapiens

    Publication: 8154046;

  12. Protection of pig kidney (PK15) cells from the cytotoxic effect of anti-pig antibodies by alpha-galactosyl oligosaccharides.

    ID: 1809704

    Description: epitope description:alpha-D-fucose host organism:Homo sapiens

    Publication: 8154046;

  13. Protection of pig kidney (PK15) cells from the cytotoxic effect of anti-pig antibodies by alpha-galactosyl oligosaccharides.

    ID: 1809706

    Description: epitope description:N-acetyl-beta-D-mannosamine host organism:Homo sapiens

    Publication: 8154046;

  14. Protection of pig kidney (PK15) cells from the cytotoxic effect of anti-pig antibodies by alpha-galactosyl oligosaccharides.

    ID: 1809713

    Description: epitope description:methyl 9-(alpha-D-galactosyloxy)nonanoate host organism:Homo sapiens

    Publication: 8154046;

  15. Protection of pig kidney (PK15) cells from the cytotoxic effect of anti-pig antibodies by alpha-galactosyl oligosaccharides.

    ID: 1809717

    Description: epitope description:melibiose host organism:Papio anubis

    Publication: 8154046;

  16. Protection of pig kidney (PK15) cells from the cytotoxic effect of anti-pig antibodies by alpha-galactosyl oligosaccharides.

    ID: 1809718

    Description: epitope description:arabinogalactan host organism:Papio anubis

    Publication: 8154046;

  17. Protection of pig kidney (PK15) cells from the cytotoxic effect of anti-pig antibodies by alpha-galactosyl oligosaccharides.

    ID: 1809726

    Description: epitope description:stachyose host organism:Papio anubis

    Publication: 8154046;

  18. Protection of pig kidney (PK15) cells from the cytotoxic effect of anti-pig antibodies by alpha-galactosyl oligosaccharides.

    ID: 1809728

    Description: epitope description:beta-D-Galp-(1->6)-D-Galp host organism:Papio anubis

    Publication: 8154046;

  19. Protection of pig kidney (PK15) cells from the cytotoxic effect of anti-pig antibodies by alpha-galactosyl oligosaccharides.

    ID: 1809737

    Description: epitope description:alpha-D-rhamnose host organism:Papio anubis

    Publication: 8154046;

  20. Protection of pig kidney (PK15) cells from the cytotoxic effect of anti-pig antibodies by alpha-galactosyl oligosaccharides.

    ID: 1809738

    Description: epitope description:N-acetyl-beta-D-mannosamine host organism:Papio anubis

    Publication: 8154046;

  21. Protection of pig kidney (PK15) cells from the cytotoxic effect of anti-pig antibodies by alpha-galactosyl oligosaccharides.

    ID: 1809739

    Description: epitope description:dextran host organism:Papio anubis

    Publication: 8154046;

  22. Protection of pig kidney (PK15) cells from the cytotoxic effect of anti-pig antibodies by alpha-galactosyl oligosaccharides.

    ID: 1809740

    Description: epitope description:D-glucose host organism:Papio anubis

    Publication: 8154046;

  23. Protection of pig kidney (PK15) cells from the cytotoxic effect of anti-pig antibodies by alpha-galactosyl oligosaccharides.

    ID: 1809749

    Description: epitope description:alpha-D-Gal-(1->3)-beta-D-Gal-(1->4)-D-Glc host organism:Homo sapiens

    Publication: 8154046;

  24. Protection of pig kidney (PK15) cells from the cytotoxic effect of anti-pig antibodies by alpha-galactosyl oligosaccharides.

    ID: 1809751

    Description: epitope description:alpha-D-Galp-(1->4)-beta-D-Galp host organism:Homo sapiens

    Publication: 8154046;

  25. Protection of pig kidney (PK15) cells from the cytotoxic effect of anti-pig antibodies by alpha-galactosyl oligosaccharides.

    ID: 1809757

    Description: epitope description:alpha-D-Gal-(1->3)-beta-D-Gal-(1->4)-D-Glc host organism:Papio anubis

    Publication: 8154046;

  26. One percent of human circulating B lymphocytes are capable of producing the natural anti-Gal antibody.

    ID: 1809765

    Description: epitope description:alpha-D-Gal-(1->3)-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->3)-beta-D-Gal-(1->4)-D-Glc-(1<->1')-Cer host organism:Homo sapiens antibody...

    Publication: 7691263;

  27. Mimotopes selected with a neutralizing antibody against urease B from Helicobacter pylori induce enzyme inhibitory antibodies in mice upon vaccination...

    ID: 1809931

    Description: epitope description:KHGLLSM host organism:Mus musculus BALB/c antibody name:U001

    Publication: 21118490;

  28. Generation and characterization of monoclonal antibodies to the phenolic glycolipid of Mycobacterium leprae.

    ID: 1810035

    Description: epitope description:3,6-di-O-methyl-beta-D-glucose antigen name:phenolic glycolipid-1 host organism:Mus musculus BALB/c antibody name:A1E, A2A, B5H

    Publication: 6360894;

  29. Anti-HLA-E mAb 3D12 mimics MEM-E/02 in binding to HLA-B and HLA-C alleles: Web-tools validate the immunogenic epitopes of HLA-E recognized by the anti...

    ID: 1810038

    Description: epitope description:DTAAQI antigen name:HLA class I histocompatibility antigen, alpha chain E host organism:Mus musculus antibody name:3D12, MEM-E/02

    Publication: 21145594;

  30. Serological characterisation of a mouse monoclonal anti-P-like antibody.

    ID: 1810039

    Description: epitope description:beta-D-Galp-(1->3)-D-GalpNAc host organism:Mus musculus BALB/c antibody name:LM147/328

    Publication: 2440182;

  31. Anti-HLA-E mAb 3D12 mimics MEM-E/02 in binding to HLA-B and HLA-C alleles: Web-tools validate the immunogenic epitopes of HLA-E recognized by the anti...

    ID: 1810050

    Description: epitope description:DTAAQI antigen name:HLA class I histocompatibility antigen, alpha chain E host organism:Mus musculus antibody name:3D12

    Publication: 21145594;

  32. Anti-HLA-E mAb 3D12 mimics MEM-E/02 in binding to HLA-B and HLA-C alleles: Web-tools validate the immunogenic epitopes of HLA-E recognized by the anti...

    ID: 1810064

    Description: epitope description:QFAYDGKDY antigen name:HLA class I histocompatibility antigen, alpha chain E host organism:Mus musculus antibody name:3D12

    Publication: 21145594;

  33. Anti-HLA-E mAb 3D12 mimics MEM-E/02 in binding to HLA-B and HLA-C alleles: Web-tools validate the immunogenic epitopes of HLA-E recognized by the anti...

    ID: 1810070

    Description: epitope description:QFAYDGKDY antigen name:HLA class I histocompatibility antigen, alpha chain E host organism:Mus musculus antibody name:3D12, MEM-E/...

    Publication: 21145594;

  34. Anti-HLA-E mAb 3D12 mimics MEM-E/02 in binding to HLA-B and HLA-C alleles: Web-tools validate the immunogenic epitopes of HLA-E recognized by the anti...

    ID: 1810075

    Description: epitope description:LNEDLRSWTA antigen name:HLA class I histocompatibility antigen, alpha chain E host organism:Mus musculus antibody name:3D12

    Publication: 21145594;

  35. Anti-HLA-E mAb 3D12 mimics MEM-E/02 in binding to HLA-B and HLA-C alleles: Web-tools validate the immunogenic epitopes of HLA-E recognized by the anti...

    ID: 1810077

    Description: epitope description:LNEDLRSWTA antigen name:HLA class I histocompatibility antigen, alpha chain E host organism:Mus musculus antibody name:3D12

    Publication: 21145594;

  36. Anti-HLA-E mAb 3D12 mimics MEM-E/02 in binding to HLA-B and HLA-C alleles: Web-tools validate the immunogenic epitopes of HLA-E recognized by the anti...

    ID: 1810083

    Description: epitope description:LNEDLRSWTA antigen name:HLA class I histocompatibility antigen, alpha chain E host organism:Mus musculus antibody name:3D12

    Publication: 21145594;

  37. A novel vascular targeting strategy for brain-derived endothelial cells using a TCR mimic antibody.

    ID: 1810091

    Description: epitope description:YLLPAIVHI antigen name:Probable ATP-dependent RNA helicase DDX5 (UniProt:P17844) host organism:Mus musculus BALB/c antibody name:R...

    Publication: 20506235;

  38. Reactivity of serum IgG anti-GM1 ganglioside antibodies with the lipopolysaccharide fractions of Campylobacter jejuni isolates from patients with Guil...

    ID: 1810106

    Description: epitope description:alpha-N-acetylneuraminosyl-(2->3)-[beta-D-galactosyl-(1->3)-N-acetyl-beta-D-galactosaminyl-(1->4)]-beta-D-galactosyl-(1->4)-beta-D...

    Publication: 9058756;

  39. Reactivity of serum IgG anti-GM1 ganglioside antibodies with the lipopolysaccharide fractions of Campylobacter jejuni isolates from patients with Guil...

    ID: 1810118

    Description: epitope description:beta-D-Gal-(1->3)-beta-D-GalNAc-(1->4)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer host organism:Homo sapiens

    Publication: 9058756;

  40. Generation of Fab fragment-like molecular recognition proteins against staphylococcal enterotoxin B by phage display technology.

    ID: 1810130

    Description: epitope description:ESQPDPKPDELHKS antigen name:UniProt:Q5HHH9 host organism:Mus musculus BALB/c

    Publication: 20844088;

  41. Generation of Fab fragment-like molecular recognition proteins against staphylococcal enterotoxin B by phage display technology.

    ID: 1810135

    Description: epitope description:ESQPDPKPDELHKS antigen name:UniProt:Q5HHH9 host organism:Mus musculus BALB/c

    Publication: 20844088;

  42. A point mutation in VP1 of coxsackievirus B4 alters antigenicity.

    ID: 1810140

    Description: epitope description:NTRQVAQLRRKMEMF antigen name:Genome polyprotein host organism:Mus musculus B10.S

    Publication: 10725201;

  43. A point mutation in VP1 of coxsackievirus B4 alters antigenicity.

    ID: 1810143

    Description: epitope description:HQEMSTATNSDVPVQ antigen name:Genome polyprotein host organism:Mus musculus B10.S

    Publication: 10725201;

  44. Epitopes of the cholera family of enterotoxins.

    ID: 1810148

    Description: epitope description:SLAGKREMAIITF antigen name:Cholera enterotoxin subunit B host organism:Oryctolagus cuniculus

    Publication: 2440089;

  45. Epitopes of the cholera family of enterotoxins.

    ID: 1810151

    Description: epitope description:LCAEYHNTQIHTL antigen name:Cholera enterotoxin subunit B host organism:Oryctolagus cuniculus

    Publication: 2440089;

  46. Epitopes of the cholera family of enterotoxins.

    ID: 1810152

    Description: epitope description:SLAGKREMAIITF antigen name:Cholera enterotoxin subunit B host organism:Oryctolagus cuniculus

    Publication: 2440089;

  47. Chemical and serological investigations on the genus-specific lipopolysaccharide epitope of Chlamydia.

    ID: 1810163

    Description: epitope description:alpha-Kdo-(2->4)-alpha-Kdo antigen name:lipopolysaccharide host organism:Mus musculus BALB/c antibody name:Clone 25

    Publication: 2436232;

  48. Comparison of host responses after intranasal infection of guinea-pigs with Mycoplasma genitalium or with Mycoplasma pneumoniae.

    ID: 1810184

    Description: epitope description:FGPHYFLNNP antigen name:Adhesin P1 host organism:Cavia porcellus

    Publication: 1895924;

  49. Antibodies induced by ganglioside-mimicking Campylobacter jejuni lipooligosaccharides recognise epitopes at the nodes of Ranvier.

    ID: 1810207

    Description: epitope description:alpha-N-acetylneuraminosyl-(2->3)-[beta-D-galactosyl-(1->3)-N-acetyl-beta-D-galactosaminyl-(1->4)]-beta-D-galactosyl-(1->4)-beta-D...

    Publication: 15993494;

  50. Antibodies induced by ganglioside-mimicking Campylobacter jejuni lipooligosaccharides recognise epitopes at the nodes of Ranvier.

    ID: 1810216

    Description: epitope description:beta-D-Gal-(1->3)-beta-D-GalNAc-(1->4)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer host organism:Oryctolagus cuniculus New Zealand W...

    Publication: 15993494;

  51. Comparison of host responses after intranasal infection of guinea-pigs with Mycoplasma genitalium or with Mycoplasma pneumoniae.

    ID: 1810220

    Description: epitope description:TDQPLSAD antigen name:Adhesin P1 host organism:Cavia porcellus

    Publication: 1895924;

  52. Antibodies induced by ganglioside-mimicking Campylobacter jejuni lipooligosaccharides recognise epitopes at the nodes of Ranvier.

    ID: 1810229

    Description: epitope description:alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->3)-beta-D-GalpNAc-(1->4)-[alpha-Neup5Ac-(2->3)]-beta-D-Galp-(1->4)-beta-D-Glcp host organism:...

    Publication: 15993494;

  53. Antibodies induced by ganglioside-mimicking Campylobacter jejuni lipooligosaccharides recognise epitopes at the nodes of Ranvier.

    ID: 1810233

    Description: epitope description:alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->3)-beta-D-GalpNAc-(1->4)-[alpha-Neup5Ac-(2->3)]-beta-D-Galp-(1->4)-beta-D-Glcp host organism:...

    Publication: 15993494;

  54. Antibodies induced by ganglioside-mimicking Campylobacter jejuni lipooligosaccharides recognise epitopes at the nodes of Ranvier.

    ID: 1810238

    Description: epitope description:beta-D-Gal-(1->3)-beta-D-GalNAc-(1->4)-[alpha-Neu5Ac-(2->8)-alpha-Neu5Ac-(2->3)]-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer host or...

    Publication: 15993494;

  55. Antibody to GalNAc-GD1a and GalNAc-GM1b in Guillain-Barré syndrome subsequent to Campylobacter jejuni enteritis.

    ID: 1810295

    Description: epitope description:beta-D-GalNAc-(1->4)-[alpha-Neu5Ac-(2->3)]-beta-D-Gal-(1->3)-beta-D-GalNAc-(1->4)-[alpha-Neu5Ac-(2->3)]-beta-D-Gal-(1->4)-beta-D-G...

    Publication: 8982115;

  56. Antibody to GalNAc-GD1a and GalNAc-GM1b in Guillain-Barré syndrome subsequent to Campylobacter jejuni enteritis.

    ID: 1810302

    Description: epitope description:beta-D-GalNAc-(1->4)-[alpha-Neu5Ac-(2->3)]-beta-D-Gal-(1->3)-beta-D-GalNAc-(1->4)-[alpha-Neu5Ac-(2->3)]-beta-D-Gal-(1->4)-beta-D-G...

    Publication: 8982115;

  57. Antibody to GalNAc-GD1a and GalNAc-GM1b in Guillain-Barré syndrome subsequent to Campylobacter jejuni enteritis.

    ID: 1810303

    Description: epitope description:beta-D-Gal-(1->3)-beta-D-GalNAc-(1->4)-[alpha-Neu5Ac-(2->8)-alpha-Neu5Ac-(2->3)]-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer host or...

    Publication: 8982115;

  58. A monoclonal IgM kappa from a blood group B individual with specificity for alpha-galactosyl epitopes on partially hydrolyzed blood group B substance.

    ID: 1810349

    Description: epitope description:alpha-D-galactosyl-(1->3)-D-galactose host organism:Homo sapiens

    Publication: 7688662;

  59. A monoclonal IgM kappa from a blood group B individual with specificity for alpha-galactosyl epitopes on partially hydrolyzed blood group B substance.

    ID: 1810351

    Description: epitope description:melibiose host organism:Homo sapiens

    Publication: 7688662;

  60. A monoclonal IgM kappa from a blood group B individual with specificity for alpha-galactosyl epitopes on partially hydrolyzed blood group B substance.

    ID: 1810352

    Description: epitope description:methyl alpha-D-galactoside host organism:Homo sapiens

    Publication: 7688662;

  61. A monoclonal IgM kappa from a blood group B individual with specificity for alpha-galactosyl epitopes on partially hydrolyzed blood group B substance.

    ID: 1810358

    Description: epitope description:N-acetyl-D-glucosamine host organism:Homo sapiens

    Publication: 7688662;

  62. A common autoepitope near the carboxyl terminus of the 60-kD Ro ribonucleoprotein: sequence similarity with a viral protein.

    ID: 1810367

    Description: epitope description:EYRKKMDI antigen name:60 kDa SS-A/Ro ribonucleoprotein host organism:Homo sapiens

    Publication: 1722217;

  63. A common autoepitope near the carboxyl terminus of the 60-kD Ro ribonucleoprotein: sequence similarity with a viral protein.

    ID: 1810374

    Description: epitope description:PAIALREY antigen name:60 kDa SS-A/Ro ribonucleoprotein host organism:Homo sapiens

    Publication: 1722217;

  64. A common autoepitope near the carboxyl terminus of the 60-kD Ro ribonucleoprotein: sequence similarity with a viral protein.

    ID: 1810376

    Description: epitope description:VHPAIALR antigen name:60 kDa SS-A/Ro ribonucleoprotein host organism:Homo sapiens

    Publication: 1722217;

  65. Structure of a major antigenic site on the respiratory syncytial virus fusion glycoprotein in complex with neutralizing antibody 101F.

    ID: 1810420

    Description: epitope description:KNRGIIKTFSN antigen name:Fusion glycoprotein F0 host organism:Mus musculus BALB/c antibody name:101F

    Publication: 20881049;

  66. The nature and combination of subunits used in epitope-based Schistosoma japonicum vaccine formulations affect their efficacy.

    ID: 1810421

    Description: epitope description:EQRLRERDEELESLRKSTTRTI antigen name:Schistosoma japonicum protein host organism:Mus musculus C57BL/6

    Publication: 21087526;

  67. The nature and combination of subunits used in epitope-based Schistosoma japonicum vaccine formulations affect their efficacy.

    ID: 1810422

    Description: epitope description:WEVRREKEELKKDKEGKVSTL antigen name:Schistosoma japonicum protein host organism:Mus musculus C57BL/6

    Publication: 21087526;

  68. Serological characterisation of a mouse monoclonal anti-P-like antibody.

    ID: 1810433

    Description: epitope description:beta-D-Galp-(1->3)-D-GalpNAc host organism:Mus musculus BALB/c antibody name:LM147/328

    Publication: 2440182;

  69. Peptides derived from alpha-helices of allogeneic class I major histocompatibility complex antigens are potent inducers of CD4+ and CD8+ T cell and B ...

    ID: 1810440

    Description: epitope description:EQIYRVDLRTLR antigen name:RT1 class I histocompatibility antigen, AA alpha chain host organism:Rattus norvegicus PVG-RT1u

    Publication: 7871571;

  70. Molecular mimicry: sensitization of Lewis rats with Campylobacter jejuni lipopolysaccharides induces formation of antibody toward GD3 ganglioside.

    ID: 1807940

    Description: epitope description:alpha-N-acetylneuraminosyl-(2->8)-alpha-N-acetylneuraminosyl-(2->3)-beta-D-galactosyl-(1->4)-beta-D-glucosyl-(1<->1')-ceramide hos...

    Publication: 16342208;

  71. Molecular mimicry: sensitization of Lewis rats with Campylobacter jejuni lipopolysaccharides induces formation of antibody toward GD3 ganglioside.

    ID: 1807942

    Description: epitope description:alpha-N-acetylneuraminosyl-(2->3)-[beta-D-galactosyl-(1->3)-N-acetyl-beta-D-galactosaminyl-(1->4)]-beta-D-galactosyl-(1->4)-beta-D...

    Publication: 16342208;

  72. Molecular mimicry: sensitization of Lewis rats with Campylobacter jejuni lipopolysaccharides induces formation of antibody toward GD3 ganglioside.

    ID: 1807952

    Description: epitope description:alpha-N-acetylneuraminosyl-(2->3)-beta-D-galactosyl-(1->3)-N-acetyl-beta-D-galactosaminyl-(1->4)-[alpha-N-acetylneuraminosyl-(2->3...

    Publication: 16342208;

  73. Molecular mimicry: sensitization of Lewis rats with Campylobacter jejuni lipopolysaccharides induces formation of antibody toward GD3 ganglioside.

    ID: 1807957

    Description: epitope description:beta-D-Gal-(1->3)-beta-D-GalNAc-(1->4)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer host organism:Rattus norvegicus Lewis

    Publication: 16342208;

  74. Alpha-galactosyl antibody redistributes alpha-galactosyl at the surface of pig blood and endothelial cells.

    ID: 1807961

    Description: epitope description:alpha-D-Galp-(1->3)-beta-D-Galp-(1->4)-D-GlcpNAc-yl group host organism:Papio anubis

    Publication: 10544440;

  75. Lack of variation in alphaGal expression on lymphocytes in miniature swine of different genotypes.

    ID: 1807966

    Description: epitope description:alpha-D-galactosyl-(1->3)-D-galactose host organism:Homo sapiens

    Publication: 10355732;

  76. Amyloid-beta oligomer specificity mediated by the IgM isotype--implications for a specific protective mechanism exerted by endogenous auto-antibodies.

    ID: 1807973

    Description: epitope description:DAEFRHDSGYEVHHQK antigen name:Amyloid beta A4 protein host organism:Mus musculus BALB/c

    Publication: 21085663;

  77. Adjuvants influence the immunoglobin subclass distribution of immune responses in vivo.

    ID: 1808027

    Description: epitope description:fluorescein isothiocyanate host organism:Mus musculus CBA

    Publication: 6424231;

  78. Functional analysis of a murine monoclonal antibody against the repetitive region of the fibronectin-binding adhesins fibronectin-binding protein A an...

    ID: 1808036

    Description: epitope description:KYEHGGNIIDIDFDSVPHIHGFNKHTEIIEEDTNKDKP antigen name:Fibronectin-binding protein A host organism:Mus musculus antibody name:15E11

    Publication: 20875085;

  79. Anti-galactose-alpha(1,3) galactose antibody production in alpha1,3-galactosyltransferase gene knockout mice after xeno and allo transplantation.

    ID: 1808037

    Description: epitope description:alpha-D-galactosyl-(1->3)-D-galactose host organism:Mus musculus C57BL/6 alpha1,3GT null

    Publication: 11005319;

  80. Anti-Galalpha1-3Gal IgM/IgG antibody levels in infants: do they have a clinical relevance in pediatric xenotransplantation?

    ID: 1808044

    Description: epitope description:alpha-D-galactosyl-(1->3)-D-galactose host organism:Homo sapiens

    Publication: 11077229;

  81. Functional analysis of a murine monoclonal antibody against the repetitive region of the fibronectin-binding adhesins fibronectin-binding protein A an...

    ID: 1808045

    Description: epitope description:KYEQGGNIVD antigen name:Fibronectin-binding protein A host organism:Mus musculus antibody name:15E11

    Publication: 20875085;

  82. Adjuvants influence the immunoglobin subclass distribution of immune responses in vivo.

    ID: 1808052

    Description: epitope description:fluorescein isothiocyanate host organism:Mus musculus CBA

    Publication: 6424231;

  83. Functional analysis of a murine monoclonal antibody against the repetitive region of the fibronectin-binding adhesins fibronectin-binding protein A an...

    ID: 1808053

    Description: epitope description:KYEHGGNIID antigen name:Fibronectin-binding protein A host organism:Mus musculus antibody name:15E11

    Publication: 20875085;

  84. The structure of anti-Gal immunoglobulin genes in naïve and stimulated Gal knockout mice.

    ID: 1808060

    Description: epitope description:alpha-D-galactosyl-(1->3)-D-galactose host organism:Mus musculus C57BL/6 alpha1,3GT null antibody name:GT4-1-M1, GT4-1-M2, GT4-1-M...

    Publication: 11740394;

  85. Functional analysis of a murine monoclonal antibody against the repetitive region of the fibronectin-binding adhesins fibronectin-binding protein A an...

    ID: 1808061

    Description: epitope description:KYEQGGNIVD antigen name:Fibronectin binding protein B, putative host organism:Mus musculus antibody name:15E11

    Publication: 20875085;

  86. IgM monoclonal antibody against terminal moiety of GM2, GalNAc-GD1a and GalNAc-GM1b from a pure motor chronic demyelinating polyneuropathy patient: ef...

    ID: 1808095

    Description: epitope description:alpha-N-acetylneuraminosyl-(2->8)-alpha-N-acetylneuraminosyl-(2->3)-beta-D-galactosyl-(1->4)-beta-D-glucosyl-(1<->1')-ceramide hos...

    Publication: 11525808;

  87. IgM monoclonal antibody against terminal moiety of GM2, GalNAc-GD1a and GalNAc-GM1b from a pure motor chronic demyelinating polyneuropathy patient: ef...

    ID: 1808096

    Description: epitope description:alpha-N-acetylneuraminosyl-(2->3)-beta-D-galactosyl-(1->3)-N-acetyl-beta-D-galactosaminyl-(1->4)-[alpha-N-acetylneuraminosyl-(2->3...

    Publication: 11525808;

  88. IgM monoclonal antibody against terminal moiety of GM2, GalNAc-GD1a and GalNAc-GM1b from a pure motor chronic demyelinating polyneuropathy patient: ef...

    ID: 1808102

    Description: epitope description:alpha-N-acetylneuraminosyl-(2->8)-alpha-N-acetylneuraminosyl-(2->3)-beta-D-galactosyl-(1->4)-beta-D-glucosyl-(1<->1')-ceramide hos...

    Publication: 11525808;

  89. IgM monoclonal antibody against terminal moiety of GM2, GalNAc-GD1a and GalNAc-GM1b from a pure motor chronic demyelinating polyneuropathy patient: ef...

    ID: 1808104

    Description: epitope description:beta-D-Gal-(1->3)-beta-D-GalNAc-(1->4)-[alpha-Neu5Ac-(2->8)-alpha-Neu5Ac-(2->3)]-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer host or...

    Publication: 11525808;

  90. Diclofenac hypersensitivity: antibody responses to the parent drug and relevant metabolites.

    ID: 1808121

    Description: epitope description:3'-hydroxydiclofenac host organism:Homo sapiens

    Publication: 21060839;

  91. Diclofenac hypersensitivity: antibody responses to the parent drug and relevant metabolites.

    ID: 1808122

    Description: epitope description:3'-hydroxydiclofenac host organism:Homo sapiens

    Publication: 21060839;

  92. Diclofenac hypersensitivity: antibody responses to the parent drug and relevant metabolites.

    ID: 1808123

    Description: epitope description:4'-hydroxydiclofenac host organism:Homo sapiens

    Publication: 21060839;

  93. Diclofenac hypersensitivity: antibody responses to the parent drug and relevant metabolites.

    ID: 1808125

    Description: epitope description:5-hydroxydiclofenac host organism:Homo sapiens

    Publication: 21060839;

  94. Diclofenac hypersensitivity: antibody responses to the parent drug and relevant metabolites.

    ID: 1808129

    Description: epitope description:3'-hydroxy-4'-methoxydiclofenac host organism:Homo sapiens

    Publication: 21060839;

  95. Diclofenac hypersensitivity: antibody responses to the parent drug and relevant metabolites.

    ID: 1808134

    Description: epitope description:5-[2-(2-oxoethoxy)ethoxy]-diclofenac host organism:Homo sapiens

    Publication: 21060839;

  96. Diclofenac hypersensitivity: antibody responses to the parent drug and relevant metabolites.

    ID: 1808136

    Description: epitope description:diclofenac host organism:Homo sapiens

    Publication: 21060839;

  97. Diclofenac hypersensitivity: antibody responses to the parent drug and relevant metabolites.

    ID: 1808138

    Description: epitope description:diclofenac host organism:Homo sapiens

    Publication: 21060839;

  98. Diclofenac hypersensitivity: antibody responses to the parent drug and relevant metabolites.

    ID: 1808142

    Description: epitope description:diclofenac host organism:Homo sapiens

    Publication: 21060839;

  99. Diclofenac hypersensitivity: antibody responses to the parent drug and relevant metabolites.

    ID: 1808143

    Description: epitope description:diclofenac host organism:Homo sapiens

    Publication: 21060839;

  100. Diclofenac hypersensitivity: antibody responses to the parent drug and relevant metabolites.

    ID: 1808150

    Description: epitope description:4'-hydroxydiclofenac host organism:Homo sapiens

    Publication: 21060839;
Displaying 100 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston