Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 100 of 1,510,353 results for " "

  1. A novel antiganglioside specificity against terminal NeuNAc(alfa 2-3)Gal in acute bulbar palsy.

    ID: 1805708

    Description: epitope description:alpha-N-acetylneuraminosyl-(2->3)-beta-D-galactosyl-(1->4)-beta-D-glucosylceramide host organism:Homo sapiens

    Publication: 16707165;

  2. Human anti-plague monoclonal antibodies protect mice from Yersinia pestis in a bubonic plague model.

    ID: 1805745

    Description: epitope description:EQNPQHFIEDLEKVRVE antigen name:Virulence-associated V antigen host organism:Homo sapiens antibody name:m253

    Publication: 20976274;

  3. Human anti-plague monoclonal antibodies protect mice from Yersinia pestis in a bubonic plague model.

    ID: 1805746

    Description: epitope description:MKKISSVIAIALFGTIA antigen name:F1 capsule antigen host organism:Homo sapiens antibody name:m252

    Publication: 20976274;

  4. Human anti-plague monoclonal antibodies protect mice from Yersinia pestis in a bubonic plague model.

    ID: 1805747

    Description: epitope description:VIAIALFGTIATANAAD antigen name:F1 capsule antigen host organism:Homo sapiens antibody name:m252

    Publication: 20976274;

  5. Binding of immunoglobulin G antibodies in Guillain-Barré syndrome sera to a mixture of GM1 and a phospholipid: possible clinical implications.

    ID: 1805783

    Description: epitope description:alpha-N-acetylneuraminosyl-(2->3)-[beta-D-galactosyl-(1->3)-N-acetyl-beta-D-galactosaminyl-(1->4)]-beta-D-galactosyl-(1->4)-beta-D...

    Publication: 12635116;

  6. Carboxyl end-specific monoclonal antibodies to amyloid beta protein (A beta) subtypes (A beta 40 and A beta 42(43)) differentiate A beta in senile pla...

    ID: 1805784

    Description: epitope description:DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV antigen name:Amyloid beta A4 protein host organism:Oryctolagus cuniculus antibody name:al...

    Publication: 8848240;

  7. Studies on monovalent anaphylactogens: evidence for a minimal size of the carbohydrate auxiliary group.

    ID: 1805787

    Description: epitope description:N(1),N(6)-bis-DNCP-1,6-hexanediamine host organism:Oryctolagus cuniculus

    Publication: 4093152;

  8. Studies on monovalent anaphylactogens: evidence for a minimal size of the carbohydrate auxiliary group.

    ID: 1805790

    Description: epitope description:2-carboxy-4,6-dinitrophenyl group host organism:Oryctolagus cuniculus

    Publication: 4093152;

  9. Insights into the mechanisms of action of anti-Abeta antibodies in Alzheimer's disease mouse models.

    ID: 1806262

    Description: epitope description:DAEFRHDSGYEVHHQK antigen name:Amyloid beta A4 protein host organism:Mus musculus antibody name:mAb40.1

    Publication: 17068112;

  10. Insights into the mechanisms of action of anti-Abeta antibodies in Alzheimer's disease mouse models.

    ID: 1806263

    Description: epitope description:DAEFRHDSGYEVHHQK antigen name:Amyloid beta A4 protein host organism:Mus musculus antibody name:4G8

    Publication: 17068112;

  11. Insights into the mechanisms of action of anti-Abeta antibodies in Alzheimer's disease mouse models.

    ID: 1806264

    Description: epitope description:LVFFAEDV antigen name:Amyloid beta A4 protein host organism:Mus musculus antibody name:4G8

    Publication: 17068112;

  12. Insights into the mechanisms of action of anti-Abeta antibodies in Alzheimer's disease mouse models.

    ID: 1806266

    Description: epitope description:DAEFRHDSGYEVHHQK antigen name:Amyloid beta A4 protein host organism:Mus musculus antibody name:mAb42.2

    Publication: 17068112;

  13. Mimotope identification from monoclonal antibodies of Burkholderia pseudomallei using random peptide phage libraries.

    ID: 1806269

    Description: epitope description:SLTPCGRTRVTSC host organism:Mus musculus antibody name:9D5

    Publication: 19121687;

  14. Insights into the mechanisms of action of anti-Abeta antibodies in Alzheimer's disease mouse models.

    ID: 1806276

    Description: epitope description:DAEFRHDSGYEVHHQK antigen name:Amyloid beta A4 protein host organism:Mus musculus antibody name:mAb40.1

    Publication: 17068112;

  15. Evidence that tilapia islets do not express alpha-(1,3)gal: implications for islet xenotransplantation.

    ID: 1806288

    Description: epitope description:alpha-D-Galp-(1->3)-beta-D-Galp-(1->4)-D-GlcpNAc-yl group host organism:Mus musculus C57BL/6 GalNAc Transferase null

    Publication: 15099208;

  16. Tolerance to self gangliosides is the major factor restricting the antibody response to lipopolysaccharide core oligosaccharides in Campylobacter jeju...

    ID: 1803951

    Description: epitope description:alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->3)-beta-D-GalNAc-(1->4)-[alpha-Neu5Ac-(2->3)]-beta-D-Gal-(1->4)-beta-D-Glc antigen name:alpha-N...

    Publication: 12183547;

  17. The tick saliva immunosuppressor, Salp15, contributes to Th17-induced pathology during Experimental Autoimmune Encephalomyelitis.

    ID: 1803952

    Description: epitope description:HSLGKWLGHPDKF host organism:Mus musculus SJL

    Publication: 20920474;

  18. Tolerance to self gangliosides is the major factor restricting the antibody response to lipopolysaccharide core oligosaccharides in Campylobacter jeju...

    ID: 1803970

    Description: epitope description:beta-D-Gal-(1->3)-beta-D-GalNAc-(1->4)-[alpha-Neu5Ac-(2->3)]-beta-D-Gal-(1->4)-beta-D-Glc antigen name:alpha-N-acetylneuraminosyl-...

    Publication: 12183547;

  19. Synthetic glycosylphosphatidylinositol microarray reveals differential antibody levels and fine specificities in children with mild and severe malaria...

    ID: 1804561

    Description: epitope description:[6-O-(2-aminoethylphosphono)-alpha-D-Man-(1->2)-alpha-D-Man-(1->6)-alpha-D-Man-(1->4)-alpha-D-GlcN-(1->6)]-1-O-(6-thiohexylphospho...

    Publication: 20471845;

  20. Synthetic glycosylphosphatidylinositol microarray reveals differential antibody levels and fine specificities in children with mild and severe malaria...

    ID: 1804564

    Description: epitope description:[alpha-D-Man-(1->2)-alpha-D-Man-(1->2)-alpha-D-Man-(1->6)-alpha-D-Man-(1->4)-alpha-D-GlcN-(1->6)]-1-O-(6-thiohexylphosphono)-D-myo...

    Publication: 20471845;

  21. A novel series of anti-human glycophorin A (CD235a) antibodies defining five extra- and intracellular epitopes.

    ID: 1804566

    Description: epitope description:ISVRTVYPPE antigen name:Glycophorin-A host organism:Mus musculus BALB/c antibody name:A63-B/C2

    Publication: 20727998;

  22. A novel series of anti-human glycophorin A (CD235a) antibodies defining five extra- and intracellular epitopes.

    ID: 1804567

    Description: epitope description:VKPLPSPDTD antigen name:Glycophorin-A host organism:Mus musculus BALB/c antibody name:A88-E/D1, A88-E/D6

    Publication: 20727998;

  23. A novel series of anti-human glycophorin A (CD235a) antibodies defining five extra- and intracellular epitopes.

    ID: 1804568

    Description: epitope description:ATPRAHEVSE antigen name:Glycophorin-A host organism:Mus musculus BALB/c antibody name:A88-A/F9, A88-D/C7, A88-E/H2

    Publication: 20727998;

  24. A novel series of anti-human glycophorin A (CD235a) antibodies defining five extra- and intracellular epitopes.

    ID: 1804587

    Description: epitope description:ATPRAHEVSE antigen name:Glycophorin-A host organism:Mus musculus BALB/c antibody name:A88-A/F9

    Publication: 20727998;

  25. A novel series of anti-human glycophorin A (CD235a) antibodies defining five extra- and intracellular epitopes.

    ID: 1804591

    Description: epitope description:ISVRTVYPPE antigen name:Glycophorin-A host organism:Mus musculus BALB/c antibody name:A63-B/C2

    Publication: 20727998;

  26. A novel series of anti-human glycophorin A (CD235a) antibodies defining five extra- and intracellular epitopes.

    ID: 1804593

    Description: epitope description:ISVRTVYPPE antigen name:Glycophorin-A host organism:Mus musculus BALB/c antibody name:A63-B/C2

    Publication: 20727998;

  27. A novel series of anti-human glycophorin A (CD235a) antibodies defining five extra- and intracellular epitopes.

    ID: 1804594

    Description: epitope description:ISVRTVYPPE antigen name:Glycophorin-A host organism:Mus musculus BALB/c antibody name:A63-B/C2

    Publication: 20727998;

  28. Selection and application of peptide mimotopes of MPT64 protein in Mycobacterium tuberculosis.

    ID: 1804597

    Description: epitope description:SDSMLSW host organism:Homo sapiens

    Publication: 20930053;

  29. A novel series of anti-human glycophorin A (CD235a) antibodies defining five extra- and intracellular epitopes.

    ID: 1804599

    Description: epitope description:VKPLPSPDTD antigen name:Glycophorin-A host organism:Mus musculus BALB/c antibody name:A88-E/D1

    Publication: 20727998;

  30. Selection and application of peptide mimotopes of MPT64 protein in Mycobacterium tuberculosis.

    ID: 1804616

    Description: epitope description:FHTHISV host organism:Oryctolagus cuniculus New Zealand White

    Publication: 20930053;

  31. High antigen levels do not preclude B-cell tolerance induction to alpha1,3-Gal via mixed chimerism.

    ID: 1804622

    Description: epitope description:alpha-D-Galp-(1->3)-beta-D-Galp-(1->4)-D-GlcpNAc-yl group host organism:Mus musculus B10.A

    Publication: 19134161;

  32. Anti-GM1 IgG antibodies in Guillain-Barré syndrome: fine specificity is associated with disease severity.

    ID: 1804632

    Description: epitope description:beta-D-Gal-(1->3)-beta-D-GalNAc-(1->4)-[alpha-Neu5Ac-(2->8)-alpha-Neu5Ac-(2->3)]-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer host or...

    Publication: 19965859;

  33. The role of hydrogen bonding via interfacial water molecules in antigen-antibody complexation. The HyHEL-10-HEL interaction.

    ID: 1804643

    Description: epitope description:H33, G34, N37, Y38, R39, W80, W81, R91, L93, N95, T107, N111, K114, K115, I116, S118, D119, G120, N121 antigen name:Gal d 4 host o...

    Publication: 12444085;

  34. Adaptive immunity against Leishmania nucleoside hydrolase maps its c-terminal domain as the target of the CD4+ T cell-driven protective response.

    ID: 1804705

    Description: epitope description:MSHEPKTITLVPT antigen name:Nonspecific nucleoside hydrolasewith=GeneDB:LmjF18.1580 host organism:Canis lupus familiaris

    Publication: 21085470;

  35. Adaptive immunity against Leishmania nucleoside hydrolase maps its c-terminal domain as the target of the CD4+ T cell-driven protective response.

    ID: 1804707

    Description: epitope description:VYEKERNTYATV antigen name:Nonspecific nucleoside hydrolasewith=GeneDB:LmjF18.1580 host organism:Canis lupus familiaris

    Publication: 21085470;

  36. Universal antibodies against the highly conserved influenza fusion peptide cross-neutralize several subtypes of influenza A virus.

    ID: 1804720

    Description: epitope description:GLFGAIAGFIEGGW antigen name:Hemagglutinin host organism:Oryctolagus cuniculus New Zealand White antibody name:Uni-1

    Publication: 21078301;

  37. A peptide mimotope of hepatitis C virus E2 protein is immunogenic in mice and block human anti-HCV sera.

    ID: 1804735

    Description: epitope description:FGEFSFQYDCSSWGC host organism:Mus musculus BALB/c

    Publication: 20827761;

  38. A peptide mimotope of hepatitis C virus E2 protein is immunogenic in mice and block human anti-HCV sera.

    ID: 1804736

    Description: epitope description:FGEFSFQYDCSSWGC host organism:Homo sapiens

    Publication: 20827761;

  39. Universal antibodies against the highly conserved influenza fusion peptide cross-neutralize several subtypes of influenza A virus.

    ID: 1804739

    Description: epitope description:GLFGAIAGFIEGGW antigen name:Hemagglutinin host organism:Oryctolagus cuniculus New Zealand White

    Publication: 21078301;

  40. Transgenic mouse brain histopathology resembles early Alzheimer's disease.

    ID: 1804744

    Description: epitope description:DAEFRHDSGYEVHHQKL antigen name:Amyloid beta A4 protein host organism:Mus musculus antibody name:4.1

    Publication: 7513982;

  41. Transgenic mouse brain histopathology resembles early Alzheimer's disease.

    ID: 1804745

    Description: epitope description:DAEFRHDSGYEVHHQKL antigen name:Amyloid beta A4 protein host organism:Mus musculus antibody name:4.1

    Publication: 7513982;

  42. Lipooligosaccharide epitopes shared among gram-negative non-enteric mucosal pathogens.

    ID: 1803993

    Description: epitope description:3-deoxy-alpha-D-manno-oct-2-ulopyranosonic acid antigen name:lipooligosaccharide host organism:Mus musculus BALB/c antibody name:3...

    Publication: 1699109;

  43. Lipooligosaccharide epitopes shared among gram-negative non-enteric mucosal pathogens.

    ID: 1803994

    Description: epitope description:3-deoxy-alpha-D-manno-oct-2-ulopyranosonic acid antigen name:lipooligosaccharide host organism:Mus musculus BALB/c antibody name:3...

    Publication: 1699109;

  44. Amyloid beta protein in rat soleus muscle in chloroquine-induced myopathy using end-specific antibodies for A beta 40 and A beta 42: immunohistochemic...

    ID: 1804017

    Description: epitope description:GLMVGGVV antigen name:Amyloid beta A4 protein host organism:Oryctolagus cuniculus antibody name:BC40

    Publication: 8787835;

  45. Mutations of an antibody binding energy hot spot on domain III of the dengue 2 envelope glycoprotein exploited for neutralization escape.

    ID: 1804057

    Description: epitope description:K307, K310, I312 antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:MAb 1A1D-2

    Publication: 20832836;

  46. Multiple antigen peptide vaccines against Plasmodium falciparum malaria.

    ID: 1804061

    Description: epitope description:ERRAKEKLQEQQRDLEQRKADTKKKPIVQYDNF host organism:Mus musculus BALB/c

    Publication: 20823210;

  47. Cholesterol-dependent generation of a unique amyloid beta-protein from apically missorted amyloid precursor protein in MDCK cells.

    ID: 1804082

    Description: epitope description:DAEFRHDSGYEVHHQK antigen name:Amyloid beta A4 protein host organism:Mus musculus BALB/c antibody name:BAN50

    Publication: 9733943;

  48. Cholesterol-dependent generation of a unique amyloid beta-protein from apically missorted amyloid precursor protein in MDCK cells.

    ID: 1804083

    Description: epitope description:MVGGVVIAT antigen name:Amyloid beta A4 protein host organism:Mus musculus BALB/c antibody name:BC05

    Publication: 9733943;

  49. Multiple antigen peptide vaccines against Plasmodium falciparum malaria.

    ID: 1804111

    Description: epitope description:SVFNVVNSSIGLIMVLSFLFLN antigen name:Circumsporozoite (CS) protein host organism:Mus musculus BALB/c

    Publication: 20823210;

  50. Cholesterol-dependent generation of a unique amyloid beta-protein from apically missorted amyloid precursor protein in MDCK cells.

    ID: 1804170

    Description: epitope description:DAEFRHDSGYEVHHQK antigen name:Amyloid beta A4 protein host organism:Mus musculus BALB/c antibody name:BAN50

    Publication: 9733943;

  51. Cholesterol-dependent generation of a unique amyloid beta-protein from apically missorted amyloid precursor protein in MDCK cells.

    ID: 1804171

    Description: epitope description:LVFFAEDV antigen name:Amyloid beta A4 protein host organism:Mus musculus BALB/c antibody name:4G8

    Publication: 9733943;

  52. Tolerance to self gangliosides is the major factor restricting the antibody response to lipopolysaccharide core oligosaccharides in Campylobacter jeju...

    ID: 1804192

    Description: epitope description:alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->3)-beta-D-GalNAc-(1->4)-[alpha-Neu5Ac-(2->3)]-beta-D-Gal-(1->4)-beta-D-Glc antigen name:alpha-N...

    Publication: 12183547;

  53. Tolerance to self gangliosides is the major factor restricting the antibody response to lipopolysaccharide core oligosaccharides in Campylobacter jeju...

    ID: 1804200

    Description: epitope description:alpha-Neu5Ac-(2->8)-alpha-Neu5Ac-(2->3)-beta-Gal-(1->3)-beta-GalNAc-(1->4)-[alpha-Neu5Ac-(2->8)-alpha-Neu5Ac-(2->3)]-beta-Gal-(1->...

    Publication: 12183547;

  54. Evaluation of a synthetic peptide as a replacement for the recombinant fusion protein of respiratory syncytial virus in a potency ELISA.

    ID: 1804273

    Description: epitope description:NSELLSLIHDMPITNDQKKLMSNNVQIVRQ host organism:Mus musculus BALB/c antibody name:Motavizumab

    Publication: 20943340;

  55. Evaluation of a synthetic peptide as a replacement for the recombinant fusion protein of respiratory syncytial virus in a potency ELISA.

    ID: 1804276

    Description: epitope description:NSELLSLINDMPITNDQKKLMSNNC host organism:Mus musculus BALB/c antibody name:Motavizumab

    Publication: 20943340;

  56. Evaluation of a synthetic peptide as a replacement for the recombinant fusion protein of respiratory syncytial virus in a potency ELISA.

    ID: 1804277

    Description: epitope description:NSELLSLINDMPITNDQKKLMSNNC host organism:Mus musculus BALB/c antibody name:Motavizumab

    Publication: 20943340;

  57. Identification of a conserved linear epitope on the VP1 protein of serotype O foot-and-mouth disease virus by neutralising monoclonal antibody 8E8.

    ID: 1804352

    Description: epitope description:DLQVLT antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 20974198;

  58. Identification of functional domains in goose interleukin 2.

    ID: 1804422

    Description: epitope description:DTLTTLIKDLEKLGTSMKKINLELYTP antigen name:Anser cygnoides (white Chinese goose) protein host organism:Mus musculus antibody name:2E...

    Publication: 20619902;

  59. Antigenic diversity of Haemophilus somnus lipooligosaccharide: phase-variable accessibility of the phosphorylcholine epitope.

    ID: 1804423

    Description: epitope description:phosphocholine antigen name:lipooligosaccharide host organism:Mus musculus antibody name:5F5.9

    Publication: 11101573;

  60. Identification of functional domains in goose interleukin 2.

    ID: 1804428

    Description: epitope description:TPNEKQECSWQTLQCYLKEIVTLENEIEDEDEI antigen name:Anser cygnoides (white Chinese goose) protein host organism:Mus musculus antibody n...

    Publication: 20619902;

  61. Comparison of serum anti-band 3 and anti-Gal antibody binding to density-separated human red blood cells.

    ID: 1804520

    Description: epitope description:alpha-D-Galp-(1->3)-beta-D-Galp-(1->4)-D-GlcpNAc-yl group host organism:Homo sapiens

    Publication: 1991171;

  62. The alpha-galactosyl epitope on human normal and autoimmune thyroid cells.

    ID: 1804521

    Description: epitope description:alpha-D-Galp-(1->3)-beta-D-Galp-(1->4)-D-GlcpNAc-yl group host organism:Homo sapiens

    Publication: 1723633;

  63. Identification of glycoconjugates which are targets for anti-Gal(beta 1-3)GalNAc autoantibodies in spinal motor neurons.

    ID: 1804527

    Description: epitope description:beta-D-Gal-(1->3)-beta-D-GalNAc-(1->4)-[alpha-Neu5Ac-(2->8)-alpha-Neu5Ac-(2->3)]-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer host or...

    Publication: 1716641;

  64. Transgenic mouse brain histopathology resembles early Alzheimer's disease.

    ID: 1804750

    Description: epitope description:DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV antigen name:Amyloid beta A4 protein host organism:Oryctolagus cuniculus antibody name:12...

    Publication: 7513982;

  65. Mimotope identification from monoclonal antibodies of Burkholderia pseudomallei using random peptide phage libraries.

    ID: 1806910

    Description: epitope description:NSLTPCGSNSLTPC host organism:Mus musculus

    Publication: 19121687;

  66. Mapping of the Neisseria meningitidis NadA cell-binding site: relevance of predicted {alpha}-helices in the NH2-terminal and dimeric coiled-coil regio...

    ID: 1807367

    Description: epitope description:KAGETIYDIDEDGTITKKD host organism:Oryctolagus cuniculus New Zealand White

    Publication: 20971901;

  67. Mapping of the Neisseria meningitidis NadA cell-binding site: relevance of predicted {alpha}-helices in the NH2-terminal and dimeric coiled-coil regio...

    ID: 1807368

    Description: epitope description:ADVEADDFKGLGLK host organism:Oryctolagus cuniculus New Zealand White

    Publication: 20971901;

  68. Mapping of the Neisseria meningitidis NadA cell-binding site: relevance of predicted {alpha}-helices in the NH2-terminal and dimeric coiled-coil regio...

    ID: 1807372

    Description: epitope description:VYTREESDSKFVRID host organism:Oryctolagus cuniculus New Zealand White

    Publication: 20971901;

  69. Mapping of the Neisseria meningitidis NadA cell-binding site: relevance of predicted {alpha}-helices in the NH2-terminal and dimeric coiled-coil regio...

    ID: 1807374

    Description: epitope description:AYNNGQEINGFKA host organism:Oryctolagus cuniculus New Zealand White

    Publication: 20971901;

  70. GM1 ganglioside-bound amyloid beta-protein in Alzheimer's disease brain.

    ID: 1807394

    Description: epitope description:DAEFRHDSGYEVHHQK antigen name:Amyloid beta A4 protein host organism:Mus musculus BALB/c antibody name:BAN50, BAN052

    Publication: 9562471;

  71. Peripheral neuropathy associated with monoclonal IgM anti-Pr2 cold agglutinins.

    ID: 1807411

    Description: epitope description:beta-D-Gal-(1->3)-beta-D-GalNAc-(1->4)-[alpha-Neu5Ac-(2->8)-alpha-Neu5Ac-(2->3)]-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer host or...

    Publication: 7693874;

  72. Peripheral neuropathy associated with monoclonal IgM anti-Pr2 cold agglutinins.

    ID: 1807416

    Description: epitope description:alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->3)-beta-beta-D-GalNAc-(1->4)-[alpha-Neu5Ac-(2->8)-alpha-Neu5Ac-(2->3)]-beta-beta-D-Gal-(1->4)-b...

    Publication: 7693874;

  73. Peripheral neuropathy associated with monoclonal IgM anti-Pr2 cold agglutinins.

    ID: 1807417

    Description: epitope description:alpha-Neu5Ac-(2->8)-alpha-Neu5Ac-(2->3)-beta-Gal-(1->3)-beta-GalNAc-(1->4)-[alpha-Neu5Ac-(2->8)-alpha-Neu5Ac-(2->3)]-beta-Gal-(1->...

    Publication: 7693874;

  74. Adult and neonatal anti-Gal response in knock-out mice for alpha1,3galactosyltransferase.

    ID: 1807429

    Description: epitope description:alpha-D-Gal-(1->3)-beta-D-Gal-(1->4)-D-GlcNAc host organism:Mus musculus C57BL/6 X DBA/2

    Publication: 9741457;

  75. Exploration of specificity in germline monoclonal antibody recognition of a range of natural and synthetic epitopes.

    ID: 1807430

    Description: epitope description:alpha-D-Kdo-(2->4)-alpha-D-Kdo-(2->4)-alpha-D-Kdo antigen name:lipopolysaccharide host organism:Mus musculus BALB/c antibody name:...

    Publication: 18272175;

  76. Species-specific distribution of alpha-galactosyl epitopes on the gastric H/K ATPase beta-subunit: relevance to the binding of human anti-parietal cel...

    ID: 1807466

    Description: epitope description:alpha-D-Galp-(1->3)-beta-D-Galp-(1->4)-D-GlcpNAc-yl group host organism:Homo sapiens

    Publication: 10336993;

  77. Adult and neonatal anti-Gal response in knock-out mice for alpha1,3galactosyltransferase.

    ID: 1807476

    Description: epitope description:alpha-D-Gal-(1->3)-beta-D-Gal-(1->4)-D-GlcNAc host organism:Mus musculus C57BL/6 X DBA/2

    Publication: 9741457;

  78. Protection of BALB/c mice from respiratory syncytial virus infection by immunization with a synthetic peptide derived from the G glycoprotein.

    ID: 1807524

    Description: epitope description:KKDPKPQTTKSKE antigen name:Major surface glycoprotein G host organism:Mus musculus BALB/c

    Publication: 1720589;

  79. Protection of BALB/c mice from respiratory syncytial virus infection by immunization with a synthetic peptide derived from the G glycoprotein.

    ID: 1807544

    Description: epitope description:NPSEITSQITTILA antigen name:Major surface glycoprotein G host organism:Mus musculus BALB/c

    Publication: 1720589;

  80. Anti-neutrophil cytoplasmic antibodies target sequential functional proteinase 3 epitopes in the sera of patients with Wegener’s granulomatosis.

    ID: 1807591

    Description: epitope description:SPALASVL antigen name:Myeloblastin host organism:Homo sapiens

    Publication: 21077276;

  81. Anti-neutrophil cytoplasmic antibodies target sequential functional proteinase 3 epitopes in the sera of patients with Wegener’s granulomatosis.

    ID: 1807599

    Description: epitope description:LALLLSGA antigen name:Myeloblastin host organism:Homo sapiens

    Publication: 21077276;

  82. Anti-neutrophil cytoplasmic antibodies target sequential functional proteinase 3 epitopes in the sera of patients with Wegener’s granulomatosis.

    ID: 1807606

    Description: epitope description:AARAAEIV antigen name:Myeloblastin host organism:Homo sapiens

    Publication: 21077276;

  83. Anti-neutrophil cytoplasmic antibodies target sequential functional proteinase 3 epitopes in the sera of patients with Wegener’s granulomatosis.

    ID: 1807607

    Description: epitope description:ARAAEIVG antigen name:Myeloblastin host organism:Homo sapiens

    Publication: 21077276;

  84. Anti-neutrophil cytoplasmic antibodies target sequential functional proteinase 3 epitopes in the sera of patients with Wegener’s granulomatosis.

    ID: 1807610

    Description: epitope description:AEIVGGHE antigen name:Myeloblastin host organism:Homo sapiens

    Publication: 21077276;

  85. Anti-neutrophil cytoplasmic antibodies target sequential functional proteinase 3 epitopes in the sera of patients with Wegener’s granulomatosis.

    ID: 1807622

    Description: epitope description:SRPYMASL antigen name:Myeloblastin host organism:Homo sapiens

    Publication: 21077276;

  86. Anti-neutrophil cytoplasmic antibodies target sequential functional proteinase 3 epitopes in the sera of patients with Wegener’s granulomatosis.

    ID: 1807625

    Description: epitope description:YMASLQMR antigen name:Myeloblastin host organism:Homo sapiens

    Publication: 21077276;

  87. Anti-neutrophil cytoplasmic antibodies target sequential functional proteinase 3 epitopes in the sera of patients with Wegener’s granulomatosis.

    ID: 1807758

    Description: epitope description:NVTVVTFF antigen name:Myeloblastin host organism:Homo sapiens

    Publication: 21077276;

  88. Anti-neutrophil cytoplasmic antibodies target sequential functional proteinase 3 epitopes in the sera of patients with Wegener’s granulomatosis.

    ID: 1807759

    Description: epitope description:VTVVTFFC antigen name:Myeloblastin host organism:Homo sapiens

    Publication: 21077276;

  89. Anti-neutrophil cytoplasmic antibodies target sequential functional proteinase 3 epitopes in the sera of patients with Wegener’s granulomatosis.

    ID: 1807764

    Description: epitope description:FFCRPHNI antigen name:Myeloblastin host organism:Homo sapiens

    Publication: 21077276;

  90. Anti-neutrophil cytoplasmic antibodies target sequential functional proteinase 3 epitopes in the sera of patients with Wegener’s granulomatosis.

    ID: 1807772

    Description: epitope description:CTFVPRRK antigen name:Myeloblastin host organism:Homo sapiens

    Publication: 21077276;

  91. Anti-neutrophil cytoplasmic antibodies target sequential functional proteinase 3 epitopes in the sera of patients with Wegener’s granulomatosis.

    ID: 1807778

    Description: epitope description:RKAGICFG antigen name:Myeloblastin host organism:Homo sapiens

    Publication: 21077276;

  92. Anti-neutrophil cytoplasmic antibodies target sequential functional proteinase 3 epitopes in the sera of patients with Wegener’s granulomatosis.

    ID: 1807797

    Description: epitope description:IQGIDSFV antigen name:Myeloblastin host organism:Homo sapiens

    Publication: 21077276;

  93. Anti-neutrophil cytoplasmic antibodies target sequential functional proteinase 3 epitopes in the sera of patients with Wegener’s granulomatosis.

    ID: 1807799

    Description: epitope description:GIDSFVIW antigen name:Myeloblastin host organism:Homo sapiens

    Publication: 21077276;

  94. Anti-neutrophil cytoplasmic antibodies target sequential functional proteinase 3 epitopes in the sera of patients with Wegener’s granulomatosis.

    ID: 1807802

    Description: epitope description:SFVIWGCA antigen name:Myeloblastin host organism:Homo sapiens

    Publication: 21077276;

  95. Anti-neutrophil cytoplasmic antibodies target sequential functional proteinase 3 epitopes in the sera of patients with Wegener’s granulomatosis.

    ID: 1807809

    Description: epitope description:ATRLFPDF antigen name:Myeloblastin host organism:Homo sapiens

    Publication: 21077276;

  96. Anti-neutrophil cytoplasmic antibodies target sequential functional proteinase 3 epitopes in the sera of patients with Wegener’s granulomatosis.

    ID: 1807818

    Description: epitope description:TRVALYVD antigen name:Myeloblastin host organism:Homo sapiens

    Publication: 21077276;

  97. Anti-neutrophil cytoplasmic antibodies target sequential functional proteinase 3 epitopes in the sera of patients with Wegener’s granulomatosis.

    ID: 1807820

    Description: epitope description:VALYVDWI antigen name:Myeloblastin host organism:Homo sapiens

    Publication: 21077276;

  98. Anti-neutrophil cytoplasmic antibodies target sequential functional proteinase 3 epitopes in the sera of patients with Wegener’s granulomatosis.

    ID: 1807821

    Description: epitope description:ALYVDWIR antigen name:Myeloblastin host organism:Homo sapiens

    Publication: 21077276;

  99. Anti-neutrophil cytoplasmic antibodies target sequential functional proteinase 3 epitopes in the sera of patients with Wegener’s granulomatosis.

    ID: 1807822

    Description: epitope description:LYVDWIRS antigen name:Myeloblastin host organism:Homo sapiens

    Publication: 21077276;

  100. Anti-neutrophil cytoplasmic antibodies target sequential functional proteinase 3 epitopes in the sera of patients with Wegener’s granulomatosis.

    ID: 1807825

    Description: epitope description:DWIRSTLR antigen name:Myeloblastin host organism:Homo sapiens

    Publication: 21077276;
Displaying 100 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston