Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Merozoite surface protein-1 epitopes recognized by antibodies that inhibit Plasmodium falciparum merozoite dispersal.

    ID: 1344094

    Description: epitope description:DLMNPDTK antigen name:Merozoite surface protein 1 host organism:Aotus antibody name:ICM-derived antibodies

    Publication: 9497045;

  2. Merozoite surface protein-1 epitopes recognized by antibodies that inhibit Plasmodium falciparum merozoite dispersal.

    ID: 1344095

    Description: epitope description:LMNPDTKE antigen name:Merozoite surface protein 1 host organism:Aotus antibody name:ICM-derived antibodies

    Publication: 9497045;

  3. Merozoite surface protein-1 epitopes recognized by antibodies that inhibit Plasmodium falciparum merozoite dispersal.

    ID: 1344102

    Description: epitope description:EKINEKII antigen name:Merozoite surface protein 1 host organism:Aotus antibody name:ICM-derived antibodies

    Publication: 9497045;

  4. Merozoite surface protein-1 epitopes recognized by antibodies that inhibit Plasmodium falciparum merozoite dispersal.

    ID: 1344105

    Description: epitope description:NEKIITDN antigen name:Merozoite surface protein 1 host organism:Aotus antibody name:ICM-derived antibodies

    Publication: 9497045;

  5. Merozoite surface protein-1 epitopes recognized by antibodies that inhibit Plasmodium falciparum merozoite dispersal.

    ID: 1344108

    Description: epitope description:IITDNKER antigen name:Merozoite surface protein 1 host organism:Aotus antibody name:ICM-derived antibodies

    Publication: 9497045;

  6. Merozoite surface protein-1 epitopes recognized by antibodies that inhibit Plasmodium falciparum merozoite dispersal.

    ID: 1344111

    Description: epitope description:DNKERKIF antigen name:Merozoite surface protein 1 host organism:Aotus antibody name:ICM-derived antibodies

    Publication: 9497045;

  7. Merozoite surface protein-1 epitopes recognized by antibodies that inhibit Plasmodium falciparum merozoite dispersal.

    ID: 1344239

    Description: epitope description:KKLTEEIK antigen name:Merozoite surface protein 1 host organism:Aotus antibody name:ICM-derived antibodies

    Publication: 9497045;

  8. Merozoite surface protein-1 epitopes recognized by antibodies that inhibit Plasmodium falciparum merozoite dispersal.

    ID: 1344246

    Description: epitope description:KSSENKIL antigen name:Merozoite surface protein 1 host organism:Aotus antibody name:ICM-derived antibodies

    Publication: 9497045;

  9. Quantitative analysis of IgA-subclass antibodies against tetanus toxoid.

    ID: 1348563

    Description: epitope description:WSVSLKGNNLIWTLKDSAGEVRQ antigen name:Tetanus toxin host organism:Homo sapiens

    Publication: 7593647;

  10. Quantitative analysis of IgA-subclass antibodies against tetanus toxoid.

    ID: 1348567

    Description: epitope description:AIREDNNITLKLDRCNNNNQYVS antigen name:Tetanus toxin host organism:Homo sapiens

    Publication: 7593647;

  11. Quantitative analysis of IgA-subclass antibodies against tetanus toxoid.

    ID: 1348572

    Description: epitope description:NAPSYTNGKLNIYYRRLYNGLKF antigen name:Tetanus toxin host organism:Homo sapiens

    Publication: 7593647;

  12. Quantitative analysis of IgA-subclass antibodies against tetanus toxoid.

    ID: 1348580

    Description: epitope description:KILGCDWYFVPTDEGWTND antigen name:Tetanus toxin host organism:Homo sapiens

    Publication: 7593647;

  13. Two distinct but overlapping antibody binding sites in the pre-S(2) region of HBsAg localized within 11 continuous residues.

    ID: 1348720

    Description: epitope description:DPRVRGLY antigen name:Large envelope protein host organism:Mus musculus C57BL/10 antibody name:Mouse sera

    Publication: 2428872;

  14. Two distinct but overlapping antibody binding sites in the pre-S(2) region of HBsAg localized within 11 continuous residues.

    ID: 1348721

    Description: epitope description:DPRVRGLY antigen name:Large envelope protein host organism:Mus musculus C57BL/10 antibody name:Mouse sera

    Publication: 2428872;

  15. B- and T-cell responses in congenic mice to repeat sequences of the malaria antigen Pf332: effects of the number of repeats.

    ID: 1348940

    Description: epitope description:SVTEEIAEEDKSVTEEIAEEDKSVTEEIAEEDK host organism:Mus musculus C57BL/10

    Publication: 8088872;

  16. B- and T-cell responses in congenic mice to repeat sequences of the malaria antigen Pf332: effects of the number of repeats.

    ID: 1348943

    Description: epitope description:SVTEEIAEEDKSVTEEIAEEDKSVTEEIAEEDKSVTEEIAEEDK host organism:Mus musculus B10.BR

    Publication: 8088872;

  17. B- and T-cell responses in congenic mice to repeat sequences of the malaria antigen Pf332: effects of the number of repeats.

    ID: 1348945

    Description: epitope description:SVTEEIAEEDKSVTEEIAEEDKSVTEEIAEEDKSVTEEIAEEDK host organism:Mus musculus B10.BR

    Publication: 8088872;

  18. B- and T-cell responses in congenic mice to repeat sequences of the malaria antigen Pf332: effects of the number of repeats.

    ID: 1348946

    Description: epitope description:SVTEEIAEEDKSVTEEIAEEDKSVTEEIAEEDKSVTEEIAEEDK host organism:Mus musculus C57BL/10

    Publication: 8088872;

  19. De novo design of peptide immunogens that mimic the coiled coil region of human T-cell leukemia virus type-1 glycoprotein 21 transmembrane subunit for...

    ID: 1348949

    Description: epitope description:LHEVDKDISQLTQAIVKNHKNLLKIAQY + ACET(L1) antigen name:Envelope glycoprotein gp62 host organism:Mus musculus ICR

    Publication: 15060075;

  20. De novo design of peptide immunogens that mimic the coiled coil region of human T-cell leukemia virus type-1 glycoprotein 21 transmembrane subunit for...

    ID: 1348955

    Description: epitope description:LHELDKDLSQLTQALVKLHKNLLKLAQY + ACET(L1) host organism:Mus musculus ICR

    Publication: 15060075;

  21. Recombinant chimeric proteins generated from conserved regions of Plasmodium falciparum merozoite surface protein 2 generate antiparasite humoral resp...

    ID: 1349055

    Description: epitope description:YNMSIRRS antigen name:Merozoite surface antigen 2 host organism:Mus musculus

    Publication: 10792760;

  22. Recombinant chimeric proteins generated from conserved regions of Plasmodium falciparum merozoite surface protein 2 generate antiparasite humoral resp...

    ID: 1349065

    Description: epitope description:PENKGTGQ antigen name:Merozoite surface antigen 2 host organism:Mus musculus

    Publication: 10792760;

  23. Recombinant chimeric proteins generated from conserved regions of Plasmodium falciparum merozoite surface protein 2 generate antiparasite humoral resp...

    ID: 1349066

    Description: epitope description:ENKGTGQH antigen name:Merozoite surface antigen 2 host organism:Mus musculus

    Publication: 10792760;

  24. Recombinant chimeric proteins generated from conserved regions of Plasmodium falciparum merozoite surface protein 2 generate antiparasite humoral resp...

    ID: 1349078

    Description: epitope description:GSRNNHPO host organism:Mus musculus

    Publication: 10792760;

  25. Recombinant chimeric proteins generated from conserved regions of Plasmodium falciparum merozoite surface protein 2 generate antiparasite humoral resp...

    ID: 1349081

    Description: epitope description:NNHPONTS host organism:Mus musculus

    Publication: 10792760;

  26. Recombinant chimeric proteins generated from conserved regions of Plasmodium falciparum merozoite surface protein 2 generate antiparasite humoral resp...

    ID: 1349085

    Description: epitope description:ONTSDSQK host organism:Mus musculus

    Publication: 10792760;

  27. Recombinant chimeric proteins generated from conserved regions of Plasmodium falciparum merozoite surface protein 2 generate antiparasite humoral resp...

    ID: 1349089

    Description: epitope description:DSQKECTD antigen name:Merozoite surface antigen 2 host organism:Mus musculus

    Publication: 10792760;

  28. Recombinant chimeric proteins generated from conserved regions of Plasmodium falciparum merozoite surface protein 2 generate antiparasite humoral resp...

    ID: 1349090

    Description: epitope description:SQKECTDG antigen name:Merozoite surface antigen 2 host organism:Mus musculus

    Publication: 10792760;

  29. Recombinant chimeric proteins generated from conserved regions of Plasmodium falciparum merozoite surface protein 2 generate antiparasite humoral resp...

    ID: 1349094

    Description: epitope description:CTDGNKEN antigen name:Merozoite surface antigen 2 host organism:Mus musculus

    Publication: 10792760;

  30. Recombinant chimeric proteins generated from conserved regions of Plasmodium falciparum merozoite surface protein 2 generate antiparasite humoral resp...

    ID: 1349095

    Description: epitope description:TDGNKENC antigen name:Merozoite surface antigen 2 host organism:Mus musculus

    Publication: 10792760;

  31. Recombinant chimeric proteins generated from conserved regions of Plasmodium falciparum merozoite surface protein 2 generate antiparasite humoral resp...

    ID: 1349120

    Description: epitope description:KVDLQPSL host organism:Mus musculus

    Publication: 10792760;

  32. Recombinant chimeric proteins generated from conserved regions of Plasmodium falciparum merozoite surface protein 2 generate antiparasite humoral resp...

    ID: 1349125

    Description: epitope description:NAYNM antigen name:Merozoite surface antigen 2 host organism:Mus musculus

    Publication: 10792760;

  33. T and B cell responses of Plasmodium falciparum malaria-immune individuals to synthetic peptides corresponding to sequences in different regions of th...

    ID: 1349132

    Description: epitope description:TVAEEHVEEPTVAEE antigen name:DNAJ protein, putative host organism:Homo sapiens

    Publication: 2478632;

  34. Immunogens containing sequences from antigen Pf332 induce Plasmodium falciparum-reactive antibodies which inhibit parasite growth but not cytoadherenc...

    ID: 1349162

    Description: epitope description:VTEEI antigen name:Antigen 332, DBL-like protein host organism:Homo sapiens antibody name:33G2

    Publication: 8552406;

  35. Location and chemical synthesis of a pre-S gene coded immunodominant epitope of hepatitis B virus.

    ID: 1349164

    Description: epitope description:MQWNSTALHQALQDPRVRGLYLPAGG antigen name:Large envelope protein host organism:Oryctolagus cuniculus antibody name:Rabbit sera

    Publication: 6200931;

  36. Immune response to synthetic peptide analogues of hepatitis B surface antigen specific for the a determinant.

    ID: 1349496

    Description: epitope description:AQGNSMF antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 6181506;

  37. A general strategy to identify mimotopes of pathological antigens using only random peptide libraries and human sera.

    ID: 1349505

    Description: epitope description:CRTCAHPGEHA host organism:Mus musculus BALB/c

    Publication: 7514533;

  38. A general strategy to identify mimotopes of pathological antigens using only random peptide libraries and human sera.

    ID: 1349506

    Description: epitope description:CRTCAHPGEHA host organism:Mus musculus C57BL/6

    Publication: 7514533;

  39. A general strategy to identify mimotopes of pathological antigens using only random peptide libraries and human sera.

    ID: 1349508

    Description: epitope description:CGPFFLAASVC host organism:Homo sapiens

    Publication: 7514533;

  40. A general strategy to identify mimotopes of pathological antigens using only random peptide libraries and human sera.

    ID: 1349509

    Description: epitope description:CGPFFLAASVC host organism:Mus musculus BALB/c

    Publication: 7514533;

  41. Human and murine antibodies cross-reactive with streptococcal M protein and myosin recognize the sequence GLN-LYS-SER-LYS-GLN in M protein.

    ID: 1349512

    Description: epitope description:EQKSKQN antigen name:UniProt:A2RGM0 host organism:Homo sapiens antibody name:Anti-myosin Abs

    Publication: 2677144;

  42. Hepatitis B virus vaccine: identification of HBsAg/a and HBsAg/d but not HBsAg/y subtype antigenic determinants on a synthetic immunogenic peptide.

    ID: 1349524

    Description: epitope description:KPTDGN antigen name:Large envelope protein host organism:Mus musculus ICR X Swiss

    Publication: 6176997;

  43. Presentation of two epitopes of the preS2 region of hepatitis B virus on live recombinant bacteria.

    ID: 1349527

    Description: epitope description:MQWNSTTFHQTLQDPRVRGLYFPAGG antigen name:Large envelope protein host organism:Oryctolagus cuniculus antibody name:anti-LamB-preS2-A

    Publication: 2442253;

  44. Neonatal and maternal immunological responses to conserved epitopes within the DBL-gamma3 chondroitin sulfate A-binding domain of Plasmodium falciparu...

    ID: 1349535

    Description: epitope description:EAFIKTAAAETFLAW antigen name:Erythrocyte membrane protein 1, PfEMP1 (UniProt:Q8I220) host organism:Homo sapiens

    Publication: 16299291;

  45. Neonatal and maternal immunological responses to conserved epitopes within the DBL-gamma3 chondroitin sulfate A-binding domain of Plasmodium falciparu...

    ID: 1349538

    Description: epitope description:DICLGTDISVKQGDV antigen name:Erythrocyte membrane protein 1, PfEMP1 (UniProt:Q8I220) host organism:Homo sapiens

    Publication: 16299291;

  46. Immunological cross-reactivity between preS2 sequences of the hepatitis B virus envelope proteins corresponding to serological subtypes adw2 and ayw.

    ID: 1349586

    Description: epitope description:MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNP antigen name:Large envelope protein host organism:Oryctolagus cuniculus antibody name:Anti-HBsA...

    Publication: 3657796;

  47. Immunological cross-reactivity between preS2 sequences of the hepatitis B virus envelope proteins corresponding to serological subtypes adw2 and ayw.

    ID: 1349596

    Description: epitope description:MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNP antigen name:Large envelope protein host organism:Oryctolagus cuniculus antibody name:Rabbit se...

    Publication: 3657796;

  48. Immune response to synthetic peptide analogues of hepatitis B surface antigen specific for the a determinant.

    ID: 1349616

    Description: epitope description:CTKPTDGNCTCIPIPSSWAF antigen name:Large envelope protein host organism:Homo sapiens

    Publication: 6181506;

  49. Immune response to synthetic peptide analogues of hepatitis B surface antigen specific for the a determinant.

    ID: 1349617

    Description: epitope description:CTKPTDGNCTCIPIPSSWAF antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 6181506;

  50. Immune response to synthetic peptide analogues of hepatitis B surface antigen specific for the a determinant.

    ID: 1349618

    Description: epitope description:TKPTDGNCTCIPIPSSWAF antigen name:Large envelope protein host organism:Homo sapiens

    Publication: 6181506;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston