Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Immune response to synthetic peptide analogues of hepatitis B surface antigen specific for the a determinant.

    ID: 1349619

    Description: epitope description:TKPTDGNCTCIPIPSSWAF antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 6181506;

  2. Immune response to synthetic peptide analogues of hepatitis B surface antigen specific for the a determinant.

    ID: 1349621

    Description: epitope description:GNCTCIPIPSSWAF antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 6181506;

  3. Immune response to synthetic peptide analogues of hepatitis B surface antigen specific for the a determinant.

    ID: 1349628

    Description: epitope description:CTKPTDGNC antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 6181506;

  4. Expression in Escherichia coli of a cloned DNA sequence encoding the pre-S2 region of hepatitis B virus.

    ID: 1349630

    Description: epitope description:MQWNSTALHQALQDPRVRGLYLPAGG antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 2415963;

  5. Immune response to synthetic peptide analogues of hepatitis B surface antigen specific for the a determinant.

    ID: 1349632

    Description: epitope description:IPIPSSWAF antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 6181506;

  6. Affinity of antibody responses in man to hepatitis B vaccine determined with synthetic peptides.

    ID: 1349638

    Description: epitope description:CTKPTDGNC antigen name:Large envelope protein host organism:Homo sapiens

    Publication: 6146750;

  7. Nonoverlapping T and B cell determinants on an hepatitis B surface antigen pre-S(2) region synthetic peptide.

    ID: 1349639

    Description: epitope description:MQWNSTTFHQTLQDPRVRGLYFPAGG antigen name:Large envelope protein host organism:Mus musculus C57BL/10

    Publication: 2425034;

  8. Nonoverlapping T and B cell determinants on an hepatitis B surface antigen pre-S(2) region synthetic peptide.

    ID: 1349643

    Description: epitope description:MQWNSTTFHQTLQDPRVRGLYFPAGG antigen name:Large envelope protein host organism:Mus musculus B10.BR

    Publication: 2425034;

  9. Nonoverlapping T and B cell determinants on an hepatitis B surface antigen pre-S(2) region synthetic peptide.

    ID: 1349670

    Description: epitope description:HQTLQDPRVRG antigen name:Large envelope protein host organism:Mus musculus B10.M

    Publication: 2425034;

  10. Nonoverlapping T and B cell determinants on an hepatitis B surface antigen pre-S(2) region synthetic peptide.

    ID: 1349715

    Description: epitope description:MQWNSTTFHQTLQ antigen name:Large envelope protein host organism:Mus musculus C3H.Q

    Publication: 2425034;

  11. Nonoverlapping T and B cell determinants on an hepatitis B surface antigen pre-S(2) region synthetic peptide.

    ID: 1349722

    Description: epitope description:MQWNSTTFHQTLQDPRVRGLYFPAGG antigen name:Large envelope protein host organism:Mus musculus C3H.Q

    Publication: 2425034;

  12. Nonoverlapping T and B cell determinants on an hepatitis B surface antigen pre-S(2) region synthetic peptide.

    ID: 1349723

    Description: epitope description:MQWNSTTFHQTLQDPRVRGLYFPAGG antigen name:Large envelope protein host organism:Mus musculus C3H.Q

    Publication: 2425034;

  13. Inhibitory activity of monoclonal antibody F35.25 on the interaction between hepatocytes (HepG2 cells) and preS1-specific ligands.

    ID: 1349724

    Description: epitope description:PAFGANSNNPDWDFNP antigen name:Large envelope protein host organism:Mus musculus antibody name:McAb F 35.25

    Publication: 1712075;

  14. Inhibitory activity of monoclonal antibody F35.25 on the interaction between hepatocytes (HepG2 cells) and preS1-specific ligands.

    ID: 1349725

    Description: epitope description:PAFGANSNNPDWDFNP antigen name:Large envelope protein host organism:Mus musculus antibody name:McAb F 35.25

    Publication: 1712075;

  15. A synthetic vaccine constructed by copolymerization of B and T cell determinants.

    ID: 1349734

    Description: epitope description:NFSTADSAKIKTLEAEKAALAARKADLEKALEGA antigen name:UniProt:A2RGM0 host organism:Mus musculus BALB/c

    Publication: 2435562;

  16. A monoclonal antibody against the X protein of hepatitis B virus: fine mapping of its epitope and application in a quantitative ELISA of the X protein...

    ID: 1349738

    Description: epitope description:HKRTLGL antigen name:Protein X host organism:Mus musculus BALB/c antibody name:B-8/2/8

    Publication: 9627056;

  17. Nonoverlapping T and B cell determinants on an hepatitis B surface antigen pre-S(2) region synthetic peptide.

    ID: 1349776

    Description: epitope description:MQWNSTTFHQTLQ antigen name:Large envelope protein host organism:Mus musculus C3H.Q

    Publication: 2425034;

  18. Nonoverlapping T and B cell determinants on an hepatitis B surface antigen pre-S(2) region synthetic peptide.

    ID: 1349822

    Description: epitope description:MQWNSTAFHQTLQ antigen name:Large envelope protein host organism:Mus musculus B10.BR

    Publication: 2425034;

  19. Nonoverlapping T and B cell determinants on an hepatitis B surface antigen pre-S(2) region synthetic peptide.

    ID: 1349823

    Description: epitope description:MQWNSTAFHQTLQ antigen name:Large envelope protein host organism:Mus musculus C3H.Q

    Publication: 2425034;

  20. Nonoverlapping T and B cell determinants on an hepatitis B surface antigen pre-S(2) region synthetic peptide.

    ID: 1349831

    Description: epitope description:MQWNSTAFHQTLQ antigen name:Large envelope protein host organism:Mus musculus C3H.Q

    Publication: 2425034;

  21. Nonoverlapping T and B cell determinants on an hepatitis B surface antigen pre-S(2) region synthetic peptide.

    ID: 1349844

    Description: epitope description:MQWNSTAFHQTLQDPRVRGLY antigen name:Large envelope protein host organism:Mus musculus C57BL/10

    Publication: 2425034;

  22. Nonoverlapping T and B cell determinants on an hepatitis B surface antigen pre-S(2) region synthetic peptide.

    ID: 1349956

    Description: epitope description:MQWNSTTFHQTLQ antigen name:Large envelope protein host organism:Mus musculus C3H.Q

    Publication: 2425034;

  23. Nonoverlapping T and B cell determinants on an hepatitis B surface antigen pre-S(2) region synthetic peptide.

    ID: 1349959

    Description: epitope description:MQWNSTALHQAL antigen name:Large envelope protein host organism:Mus musculus C3H.Q

    Publication: 2425034;

  24. Nonoverlapping T and B cell determinants on an hepatitis B surface antigen pre-S(2) region synthetic peptide.

    ID: 1349960

    Description: epitope description:MQWNSTTFHQTLQ antigen name:Large envelope protein host organism:Mus musculus C3H.Q

    Publication: 2425034;

  25. Hybrid hepatitis B virus nucleocapsid bearing an immunodominant region from hepatitis B virus surface antigen.

    ID: 1349968

    Description: epitope description:PGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTC antigen name:Large envelope protein host organism:Mus musculus antibody name:anti-HBc&Delt...

    Publication: 7684473;

  26. Serum anti-GQ1b IgG antibodies recognize surface epitopes on Campylobacter jejuni from patients with Miller Fisher syndrome.

    ID: 1349971

    Description: epitope description:alpha-Neu5Ac-(2->8)-alpha-Neu5Ac-(2->3)-beta-Gal-(1->3)-beta-GalNAc-(1->4)-[alpha-Neu5Ac-(2->8)-alpha-Neu5Ac-(2->3)]-beta-Gal-(1->...

    Publication: 7531419;

  27. A monoclonal antibody against a hepatitis B e antigen epitope borne by six amino acids encoded by the precore region.

    ID: 1349992

    Description: epitope description:IDPY antigen name:External core antigen host organism:Mus musculus antibody name:19C1-8

    Publication: 9389411;

  28. A monoclonal antibody against a hepatitis B e antigen epitope borne by six amino acids encoded by the precore region.

    ID: 1350004

    Description: epitope description:RPPNAPIL antigen name:External core antigen host organism:Mus musculus antibody name:C33

    Publication: 9389411;

  29. Localization of the amino terminus of the hepatitis B virus core antigen within the core particle.

    ID: 1350023

    Description: epitope description:MDIDPYKEFGA antigen name:Capsid protein host organism:Mus musculus BALB/c antibody name:E1A7

    Publication: 9453141;

  30. Nonoverlapping T and B cell determinants on an hepatitis B surface antigen pre-S(2) region synthetic peptide.

    ID: 1350038

    Description: epitope description:MQWNSTTFHQTLQ antigen name:Large envelope protein host organism:Mus musculus C3H.Q

    Publication: 2425034;

  31. Nonoverlapping T and B cell determinants on an hepatitis B surface antigen pre-S(2) region synthetic peptide.

    ID: 1350039

    Description: epitope description:MQWNSTTFHQTLQDPRVRGLYFPAGG antigen name:Large envelope protein host organism:Mus musculus C3H.Q

    Publication: 2425034;

  32. Antibodies to synthetic peptides from the pre-S1 and pre-S2 regions of one subtype of the hepatitis B virus (HBV) envelope protein recognize all HBV s...

    ID: 1350067

    Description: epitope description:MQWNSTAFHQTLQDPRVRGLYLPAGGSSSGTVNP antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 3657811;

  33. Antibodies to synthetic peptides from the pre-S1 and pre-S2 regions of one subtype of the hepatitis B virus (HBV) envelope protein recognize all HBV s...

    ID: 1350084

    Description: epitope description:NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 3657811;

  34. Antibodies to synthetic peptides from the pre-S1 and pre-S2 regions of one subtype of the hepatitis B virus (HBV) envelope protein recognize all HBV s...

    ID: 1350087

    Description: epitope description:NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 3657811;

  35. Antibodies to synthetic peptides from the pre-S1 and pre-S2 regions of one subtype of the hepatitis B virus (HBV) envelope protein recognize all HBV s...

    ID: 1350100

    Description: epitope description:PLGFFPDHQLDPAFGANSNNPDWDFNP antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 3657811;

  36. Antibodies to synthetic peptides from the pre-S1 and pre-S2 regions of one subtype of the hepatitis B virus (HBV) envelope protein recognize all HBV s...

    ID: 1350104

    Description: epitope description:PLGFFPDHQLDPAFGANSNNPDWDFNP antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 3657811;

  37. Identification and characterization of a C(K/R)TC motif as a common epitope present in all subtypes of hepatitis B surface antigen.

    ID: 1350108

    Description: epitope description:CKTC antigen name:Large envelope protein host organism:Mus musculus BALB/c antibody name:H166

    Publication: 8617960;

  38. Antibodies to synthetic peptides from the pre-S1 and pre-S2 regions of one subtype of the hepatitis B virus (HBV) envelope protein recognize all HBV s...

    ID: 1350111

    Description: epitope description:PLGFFPDHQLDPAFRANTANPDWDFNP antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 3657811;

  39. Recombinant chimeric proteins generated from conserved regions of Plasmodium falciparum merozoite surface protein 2 generate antiparasite humoral resp...

    ID: 1350129

    Description: epitope description:KENCGA antigen name:Merozoite surface antigen 2 host organism:Mus musculus

    Publication: 10792760;

  40. Recombinant chimeric proteins generated from conserved regions of Plasmodium falciparum merozoite surface protein 2 generate antiparasite humoral resp...

    ID: 1350130

    Description: epitope description:TSLLSNS antigen name:Other Plasmodium falciparum (malaria parasite P. falciparum) protein host organism:Mus musculus

    Publication: 10792760;

  41. Recombinant chimeric proteins generated from conserved regions of Plasmodium falciparum merozoite surface protein 2 generate antiparasite humoral resp...

    ID: 1350138

    Description: epitope description:TTTTTKTTTTT antigen name:Merozoite surface antigen 2 host organism:Mus musculus Quackenbush

    Publication: 10792760;

  42. Recombinant chimeric proteins generated from conserved regions of Plasmodium falciparum merozoite surface protein 2 generate antiparasite humoral resp...

    ID: 1350139

    Description: epitope description:KNAETNPKGKGEVQ antigen name:Merozoite surface antigen 2 host organism:Homo sapiens

    Publication: 10792760;

  43. Recombinant chimeric proteins generated from conserved regions of Plasmodium falciparum merozoite surface protein 2 generate antiparasite humoral resp...

    ID: 1350140

    Description: epitope description:KNAETNPKGKGEVQ antigen name:Merozoite surface antigen 2 host organism:Mus musculus Quackenbush

    Publication: 10792760;

  44. A novel microencapsulated peptide vaccine against hepatitis B.

    ID: 1350267

    Description: epitope description:CKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWAS antigen name:Large envelope protein host organism:Mus musculus BALB/c

    Publication: 11312028;

  45. Chemically synthesized peptides predicted from the nucleotide sequence of the hepatitis B virus genome elicit antibodies reactive with the native enve...

    ID: 1350293

    Description: epitope description:CLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFI antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 6167985;

  46. Chemically synthesized peptides predicted from the nucleotide sequence of the hepatitis B virus genome elicit antibodies reactive with the native enve...

    ID: 1350318

    Description: epitope description:LTRILTIPQSLDSW antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 6167985;

  47. Chemically synthesized peptides predicted from the nucleotide sequence of the hepatitis B virus genome elicit antibodies reactive with the native enve...

    ID: 1350323

    Description: epitope description:SLDSW antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 6167985;

  48. Chemically synthesized peptides predicted from the nucleotide sequence of the hepatitis B virus genome elicit antibodies reactive with the native enve...

    ID: 1350333

    Description: epitope description:FLPLLPIFFCLWVYI antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 6167985;

  49. Chemically synthesized peptides predicted from the nucleotide sequence of the hepatitis B virus genome elicit antibodies reactive with the native enve...

    ID: 1350336

    Description: epitope description:CLWVYI antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 6167985;

  50. Immune response to the pre-S(1) region of the hepatitis B surface antigen (HBsAg): a pre-S(1)-specific T cell response can bypass nonresponsiveness to...

    ID: 1350393

    Description: epitope description:PAFGANSNNPDWDFNPVKDDWP antigen name:Large envelope protein host organism:Mus musculus

    Publication: 2423607;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston