Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "
  1. Immune response to the pre-S(1) region of the hepatitis B surface antigen (HBsAg): a pre-S(1)-specific T cell response can bypass nonresponsiveness to...

    ID: 1350399

    Description: epitope description:MGTNLSVPNPLGFFPDHQLDP antigen name:Large envelope protein host organism:Homo sapiens

    Publication: 2423607;
  2. Immune response to the pre-S(1) region of the hepatitis B surface antigen (HBsAg): a pre-S(1)-specific T cell response can bypass nonresponsiveness to...

    ID: 1350400

    Description: epitope description:PAFGANSNNPDWDFNPVKDDWP antigen name:Large envelope protein host organism:Homo sapiens

    Publication: 2423607;
  3. Localization of hepatitis B surface antigen epitopes present on variants and specifically recognised by anti-hepatitis B surface antigen monoclonal an...

    ID: 1350406

    Description: epitope description:DYQGMLPVCP antigen name:Large envelope protein host organism:Mus musculus BALB/c antibody name:6H6B6

    Publication: 11536229;
  4. Localization of hepatitis B surface antigen epitopes present on variants and specifically recognised by anti-hepatitis B surface antigen monoclonal an...

    ID: 1350407

    Description: epitope description:DYQGMLPVCP antigen name:Large envelope protein host organism:Mus musculus BALB/c antibody name:6H6B6

    Publication: 11536229;
  5. Distinction between immunogenicity and tolerogenicity among HBcAg T cell determinants. Influence of peptide-MHC interaction.

    ID: 1350544

    Description: epitope description:VSFGVWIRTPPAYRPPNAPIL antigen name:Capsid protein host organism:Mus musculus B10.S antibody name:Mouse sera

    Publication: 2478619;
  6. Distinction between immunogenicity and tolerogenicity among HBcAg T cell determinants. Influence of peptide-MHC interaction.

    ID: 1350545

    Description: epitope description:VSFGVWIRTPPAYRPPNAPIL antigen name:Capsid protein host organism:Mus musculus B10.S antibody name:Mouse sera

    Publication: 2478619;
  7. A synthetic peptide spontaneously self-assembles to reconstruct a group-specific, conformational determinant of hepatitis B surface antigen.

    ID: 1350569

    Description: epitope description:CTTPAQGNSMFPSCCCTKPTDGNC antigen name:Large envelope protein host organism:Equus caballus

    Publication: 1376348;
  8. A synthetic peptide spontaneously self-assembles to reconstruct a group-specific, conformational determinant of hepatitis B surface antigen.

    ID: 1350571

    Description: epitope description:CTTPAQGNSMFPSCCCTKPTDGNC antigen name:Large envelope protein host organism:Homo sapiens

    Publication: 1376348;
  9. A synthetic peptide spontaneously self-assembles to reconstruct a group-specific, conformational determinant of hepatitis B surface antigen.

    ID: 1350640

    Description: epitope description:CTTPAQGNSMFPSCCCTKPTDGNC antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 1376348;
  10. Derivation of vaccines from mimotopes. Immunologic properties of human hepatitis B virus surface antigen mimotopes displayed on filamentous phage.

    ID: 1350668

    Description: epitope description:VTCDTPPTY host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7534789;
  11. Derivation of vaccines from mimotopes. Immunologic properties of human hepatitis B virus surface antigen mimotopes displayed on filamentous phage.

    ID: 1350671

    Description: epitope description:RTCAHPGEH host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7534789;
  12. Derivation of vaccines from mimotopes. Immunologic properties of human hepatitis B virus surface antigen mimotopes displayed on filamentous phage.

    ID: 1350679

    Description: epitope description:GPFFLSPTS host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7534789;
  13. Derivation of vaccines from mimotopes. Immunologic properties of human hepatitis B virus surface antigen mimotopes displayed on filamentous phage.

    ID: 1350682

    Description: epitope description:GPFYTSAPQ host organism:Mus musculus

    Publication: 7534789;
  14. Discontinuous epitopes of hepatitis B surface antigen derived from a filamentous phage peptide library.

    ID: 1350695

    Description: epitope description:EQFAKTCPMQAVKGGWASTLCRSVYSGNVR host organism:Mus musculus antibody name:H5

    Publication: 8700874;
  15. Discontinuous epitopes of hepatitis B surface antigen derived from a filamentous phage peptide library.

    ID: 1350697

    Description: epitope description:LTEVVISRSADCRFRDVITGECCGWHRGCF host organism:Mus musculus antibody name:H5

    Publication: 8700874;
  16. Immunogenicity of synthetic peptides derived from Plasmodium falciparum proteins.

    ID: 1345604

    Description: epitope description:DKNEKGQHEIVEVEEILPEDKNEKGQHEIVEVEEILPE host organism:Oryctolagus cuniculus New Zealand White

    Publication: 16513113;
  17. Merozoite surface protein-3: a malaria protein inducing antibodies that promote Plasmodium falciparum killing by cooperation with blood monocytes.

    ID: 1345617

    Description: epitope description:AKEASSYDYILGWEFGGGVPEHKKEEN antigen name:Merozoite surface protein 3 host organism:Mus musculus

    Publication: 8068948;
  18. Merozoite surface protein-3: a malaria protein inducing antibodies that promote Plasmodium falciparum killing by cooperation with blood monocytes.

    ID: 1345618

    Description: epitope description:AKEASSYDYILGWEFGGGVPEHKKEEN antigen name:Merozoite surface protein 3 host organism:Homo sapiens

    Publication: 8068948;
  19. Serum antibodies from malaria-exposed people recognize conserved epitopes formed by the two epidermal growth factor motifs of MSP1(19), the carboxy-te...

    ID: 1345659

    Description: epitope description:NISQHQCVKKQCPQNSGCFRHLDEREECKCLLNYKQEGDKCVENPNPT antigen name:Merozoite surface protein 1 host organism:Homo sapiens

    Publication: 7822010;
  20. Definition of T cell epitopes within the 19 kDa carboxylterminal fragment of Plasmodium yoelii merozoite surface protein 1 (MSP1(19)) and their role i...

    ID: 1345662

    Description: epitope description:LLGYKKGEGNTCVENNNPTC antigen name:Merozoite surface protein 1 host organism:Mus musculus C57BL/6

    Publication: 9651928;
  21. Towards a synthetic malaria vaccine: cyclization of a peptide eliminates the production of parasite-unreactive antibody.

    ID: 1345675

    Description: epitope description:NANPNANPNANP antigen name:Circumsporozoite (CS) protein host organism:Mus musculus BALB/c antibody name:A24, A5, A8, MB4, A1/4, A5...

    Publication: 8099745;
  22. Towards a synthetic malaria vaccine: cyclization of a peptide eliminates the production of parasite-unreactive antibody.

    ID: 1345676

    Description: epitope description:NANPNANPNANP antigen name:Circumsporozoite (CS) protein host organism:Mus musculus BALB/c antibody name:A24, A5, A11, MB4, A1/4, A...

    Publication: 8099745;
  23. Epitope specificity and capacity to inhibit parasite growth in vitro of human antibodies to repeat sequences of the Plasmodium falciparum antigen Ag33...

    ID: 1345716

    Description: epitope description:YSVTEEIAEEDKSVTEEIAEEDK host organism:Homo sapiens antibody name:Human sera

    Publication: 7692377;
  24. Persistence of cellular and humoral response to synthetic peptides from defined Plasmodium falciparum antigens.

    ID: 1345720

    Description: epitope description:EENVEHDAEENVEHDAEENVEHDAEENVEHDA antigen name:DNAJ protein, putative host organism:Homo sapiens

    Publication: 1720947;
  25. Persistence of cellular and humoral response to synthetic peptides from defined Plasmodium falciparum antigens.

    ID: 1345729

    Description: epitope description:NANPNANPNANPNANPNANP antigen name:Circumsporozoite (CS) protein host organism:Homo sapiens

    Publication: 1720947;
  26. Epitope specificity and capacity to inhibit parasite growth in vitro of human antibodies to repeat sequences of the Plasmodium falciparum antigen Ag33...

    ID: 1345747

    Description: epitope description:VTEEI antigen name:Antigen 332, DBL-like protein host organism:Homo sapiens antibody name:MoAb 33G2

    Publication: 7692377;
  27. Immunogenicity of synthetic peptides derived from Plasmodium falciparum proteins.

    ID: 1345785

    Description: epitope description:DKNEKGQHEIVEVEEILPEEPLIEEVEVIEHEVKENKD host organism:Oryctolagus cuniculus New Zealand White

    Publication: 16513113;
  28. Immunogenicity of synthetic peptides derived from Plasmodium falciparum proteins.

    ID: 1345834

    Description: epitope description:AHHAADAHHAADAHHAAD antigen name:Serine/Threonine protein kinase, FIKK family host organism:Oryctolagus cuniculus New Zealand White

    Publication: 16513113;
  29. Immunogenicity of synthetic peptides derived from Plasmodium falciparum proteins.

    ID: 1345839

    Description: epitope description:DAHHAADAHHATDAHHA antigen name:Serine/Threonine protein kinase, FIKK family host organism:Oryctolagus cuniculus New Zealand White

    Publication: 16513113;
  30. Towards the design of heterovalent anti-malaria vaccines: a hybrid immunogen capable of eliciting immune responses to epitopes of circumsporozoite ant...

    ID: 1345890

    Description: epitope description:IEKKIAKMEKASSVFNVV host organism:Homo sapiens

    Publication: 1721043;
  31. Towards the design of heterovalent anti-malaria vaccines: a hybrid immunogen capable of eliciting immune responses to epitopes of circumsporozoite ant...

    ID: 1345975

    Description: epitope description:QGPGAPQGPGAPQGPGAP antigen name:Circumsporozoite protein (UniProt:Q7RJT9) host organism:Mus musculus BALB/c

    Publication: 1721043;
  32. Immunogenicity of synthetic peptides derived from Plasmodium falciparum proteins.

    ID: 1346103

    Description: epitope description:AHHAADAHHAADAHHAADAHHAAD host organism:Oryctolagus cuniculus New Zealand White

    Publication: 16513113;
  33. A 'first loop' linear epitope accessible on native hepatitis B surface antigen that persists in the face of 'second loop' immune escape.

    ID: 1346221

    Description: epitope description:CRTCMTTAQGTSMY antigen name:Large envelope protein host organism:Mus musculus BALB/c antibody name:mAb P2D3

    Publication: 12560557;
  34. A 'first loop' linear epitope accessible on native hepatitis B surface antigen that persists in the face of 'second loop' immune escape.

    ID: 1346223

    Description: epitope description:YFPAGGSSSGTLNPV antigen name:Large envelope protein host organism:Mus musculus BALB/c antibody name:mAb P2D3

    Publication: 12560557;
  35. A 'first loop' linear epitope accessible on native hepatitis B surface antigen that persists in the face of 'second loop' immune escape.

    ID: 1346231

    Description: epitope description:TGPCKTCTIPAQ antigen name:Large envelope protein host organism:Mus musculus BALB/c antibody name:mAb P2D3

    Publication: 12560557;
  36. Involvement of Pf155/RESA and cross-reactive antigens in Plasmodium falciparum merozoite invasion in vitro.

    ID: 1346438

    Description: epitope description:EENVEHDA antigen name:DNAJ protein, putative host organism:Homo sapiens antibody name:Anti-EENVEHDA

    Publication: 1730474;
  37. Involvement of Pf155/RESA and cross-reactive antigens in Plasmodium falciparum merozoite invasion in vitro.

    ID: 1346439

    Description: epitope description:EENVEENV antigen name:DNAJ protein, putative host organism:Homo sapiens antibody name:Anti-(EENV)2

    Publication: 1730474;
  38. Involvement of Pf155/RESA and cross-reactive antigens in Plasmodium falciparum merozoite invasion in vitro.

    ID: 1346451

    Description: epitope description:SVTEEIAEEDKSVIEEAV antigen name:Antigen 332, DBL-like protein host organism:Oryctolagus cuniculus antibody name:Anti-LJ14

    Publication: 1730474;
  39. Plasmodium falciparum: intragenic recombination and nonrandom associations between polymorphic domains of the precursor to the major merozoite surface...

    ID: 1346465

    Description: epitope description:Q127, Q287 antigen name:Merozoite surface protein 1 host organism:Mus musculus antibody name:9.5-1-5-1.

    Publication: 1720396;
  40. Plasmodium falciparum: intragenic recombination and nonrandom associations between polymorphic domains of the precursor to the major merozoite surface...

    ID: 1346513

    Description: epitope description:TLLDKNKKIEE antigen name:Merozoite surface protein 1 host organism:Mus musculus antibody name:10-2B

    Publication: 1720396;
  41. Epitopes of the human malaria parasite P. falciparum carried on the surface of HBsAg particles elicit an immune response against the parasite.

    ID: 1346615

    Description: epitope description:IEESKKTIDKNKNATKEEEKKKLYQA antigen name:Merozoite surface protein 1 host organism:Oryctolagus cuniculus

    Publication: 1716808;
  42. Chemically synthesized peptides of hepatitis B surface antigen duplicate the d/y specificities and induce subtype-specific antibodies in chimpanzees.

    ID: 1346720

    Description: epitope description:FPGSSTTSTGPCRTCMTTAQGTSMYPSC antigen name:Large envelope protein host organism:Oryctolagus cuniculus antibody name:Rabbit sera

    Publication: 6188163;
  43. Identification of Caucasian CD4 T cell epitopes on the circumsporozoite protein of Plasmodium vivax. T cell memory.

    ID: 1346730

    Description: epitope description:DRAAGQPAGDRAAGQPAGDRA antigen name:Circumsporozoite protein, putative host organism:Mus musculus C57BL/10

    Publication: 7687623;
  44. Identification of Caucasian CD4 T cell epitopes on the circumsporozoite protein of Plasmodium vivax. T cell memory.

    ID: 1346731

    Description: epitope description:GANAPNEKSVKEYLDKVRAT antigen name:Circumsporozoite protein, putative host organism:Mus musculus C57BL/10

    Publication: 7687623;
  45. Reproducing the immune response against the Plasmodium vivax merozoite surface protein 1 with mimotopes selected from a phage-displayed peptide librar...

    ID: 1346746

    Description: epitope description:YSPEVR host organism:Mus musculus Biozzi

    Publication: 8960114;
  46. Chemically synthesized peptides of hepatitis B surface antigen duplicate the d/y specificities and induce subtype-specific antibodies in chimpanzees.

    ID: 1346758

    Description: epitope description:FPGSSTTSTGPCRTCMTTAQGTSMYPSC antigen name:Large envelope protein host organism:Pan troglodytes antibody name:Chimpanzee sera

    Publication: 6188163;
  47. Involvement of the Zn-binding region of tetanus toxin in B and T recognition. Influence of Zn fixation.

    ID: 1346768

    Description: epitope description:ELIHVLHGLYGMQVSS antigen name:Tetanus toxin host organism:Oryctolagus cuniculus

    Publication: 7679184;
  48. Chemically synthesized peptides of hepatitis B surface antigen duplicate the d/y specificities and induce subtype-specific antibodies in chimpanzees.

    ID: 1346778

    Description: epitope description:FPGSSTTSTGPCRTCMTTAQGTSMYPSC antigen name:Large envelope protein host organism:Pan troglodytes antibody name:Chimpanzee sera

    Publication: 6188163;
  49. Monoclonal antibody against the Plasmodium falciparum chitinase, PfCHT1, recognizes a malaria transmission-blocking epitope in Plasmodium gallinaceum ...

    ID: 1346789

    Description: epitope description:LYDSYAYYG antigen name:Chitinase host organism:Mus musculus antibody name:1C3

    Publication: 11854247;
  50. Mapping and comparison of the B-cell epitopes recognized on the Plasmodium vivax circumsporozoite protein by immune Colombians and immunized Aotus mon...

    ID: 1346790

    Description: epitope description:GDAKKKKDGKKAEPKNPREN antigen name:Circumsporozoite protein, putative host organism:Homo sapiens antibody name:immune sera

    Publication: 9797827;

Displaying 50 of 1,510,353 results for " "