Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 100 of 1,510,353 results for " "

  1. Identification and characterization of a cross-neutralization epitope of Enterovirus 71.

    ID: 1853083

    Description: epitope description:WSGSLEVTFMFTGSF antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 21501643;

  2. Identification and characterization of a cross-neutralization epitope of Enterovirus 71.

    ID: 1853089

    Description: epitope description:MATGKMLIAYTPPGG antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 21501643;

  3. Identification and characterization of a cross-neutralization epitope of Enterovirus 71.

    ID: 1853103

    Description: epitope description:LQSSVTLVIPWISNT antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 21501643;

  4. Identification and characterization of a cross-neutralization epitope of Enterovirus 71.

    ID: 1853109

    Description: epitope description:HYRAHARDGVFDYYT antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 21501643;

  5. Identification and characterization of a cross-neutralization epitope of Enterovirus 71.

    ID: 1853113

    Description: epitope description:FDYYTTGLVSIWYQT antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 21501643;

  6. Identification and characterization of a cross-neutralization epitope of Enterovirus 71.

    ID: 1853121

    Description: epitope description:IGAPNTAYIIALAAA antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 21501643;

  7. Identification and characterization of a cross-neutralization epitope of Enterovirus 71.

    ID: 1853132

    Description: epitope description:DASDILQTGTIQ antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 21501643;

  8. Identification and characterization of a cross-neutralization epitope of Enterovirus 71.

    ID: 1853156

    Description: epitope description:FGEHKQEKDLEYGAC antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:E1

    Publication: 21501643;

  9. Identification and characterization of a cross-neutralization epitope of Enterovirus 71.

    ID: 1853164

    Description: epitope description:DGYPTFGEHKQEKDL antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:E1

    Publication: 21501643;

  10. Surface plasmon resonance analysis of antipolysaccharide antibody specificity: responses to meningococcal group C conjugate vaccines and bacteria.

    ID: 1853194

    Description: epitope description:[9)-alpha-Neu5,7,8Ac3-(2->]n antigen name:polysaccharide host organism:Mus musculus BALB/c

    Publication: 15155652;

  11. Surface plasmon resonance analysis of antipolysaccharide antibody specificity: responses to meningococcal group C conjugate vaccines and bacteria.

    ID: 1853196

    Description: epitope description:[9)-alpha-Neu5,7,8Ac3-(2->]n antigen name:polysaccharide host organism:Mus musculus BALB/c

    Publication: 15155652;

  12. Surface plasmon resonance analysis of antipolysaccharide antibody specificity: responses to meningococcal group C conjugate vaccines and bacteria.

    ID: 1853197

    Description: epitope description:[9)-alpha-Neu5,7,8Ac3-(2->]n antigen name:polysaccharide host organism:Mus musculus BALB/c

    Publication: 15155652;

  13. Surface plasmon resonance analysis of antipolysaccharide antibody specificity: responses to meningococcal group C conjugate vaccines and bacteria.

    ID: 1853198

    Description: epitope description:[9)-alpha-Neu5,7,8Ac3-(2->]n antigen name:polysaccharide host organism:Mus musculus BALB/c

    Publication: 15155652;

  14. Surface plasmon resonance analysis of antipolysaccharide antibody specificity: responses to meningococcal group C conjugate vaccines and bacteria.

    ID: 1853203

    Description: epitope description:[9)-alpha-Neu5,7,8Ac3-(2->]n antigen name:polysaccharide host organism:Mus musculus BALB/c

    Publication: 15155652;

  15. Surface plasmon resonance analysis of antipolysaccharide antibody specificity: responses to meningococcal group C conjugate vaccines and bacteria.

    ID: 1853208

    Description: epitope description:[9)-alpha-Neu5Ac-(2->]n antigen name:polysaccharide host organism:Mus musculus BALB/c

    Publication: 15155652;

  16. Immunodiagnostically applicable monoclonal antibodies to the circulating anodic antigen of Schistosoma mansoni bind to small, defined oligosaccharide ...

    ID: 1853225

    Description: epitope description:beta-D-GalpNAc-(1->6)-[beta-D-GlcpA-(1->3)]-beta-D-GalpNAc-(1->6)-[beta-D-GlcpA-(1->3)]-beta-D-GalpNAc antigen name:proteoglycan h...

    Publication: 12695908;

  17. Immunodiagnostically applicable monoclonal antibodies to the circulating anodic antigen of Schistosoma mansoni bind to small, defined oligosaccharide ...

    ID: 1853227

    Description: epitope description:beta-D-GlcpA-(1->3)-[beta-D-GlcpA-(1->3)-beta-D-GalpNAc-(1->6)]-beta-D-GalpNAc antigen name:proteoglycan host organism:Mus musculu...

    Publication: 12695908;

  18. Structural basis of immunosuppression by the therapeutic antibody daclizumab.

    ID: 1853231

    Description: epitope description:E22, L23, D25, D26, D27, M46, N48, L63, Y64, I139, H141, M170, T171, H172, G173, K174, T175, R176 antigen name:Interleukin-2 recep...

    Publication: 20820193;

  19. Immunodiagnostically applicable monoclonal antibodies to the circulating anodic antigen of Schistosoma mansoni bind to small, defined oligosaccharide ...

    ID: 1853236

    Description: epitope description:beta-D-GlcpA-(1->3)-[beta-D-GlcpA-(1->3)-beta-D-GalpNAc-(1->6)]-beta-D-GalpNAc antigen name:proteoglycan host organism:Mus musculu...

    Publication: 12695908;

  20. Immunodiagnostically applicable monoclonal antibodies to the circulating anodic antigen of Schistosoma mansoni bind to small, defined oligosaccharide ...

    ID: 1853237

    Description: epitope description:beta-D-GlcpA-(1->3)-[beta-D-GlcpA-(1->3)-beta-D-GalpNAc-(1->6)]-beta-D-GalpNAc antigen name:proteoglycan host organism:Mus musculu...

    Publication: 12695908;

  21. Immunodiagnostically applicable monoclonal antibodies to the circulating anodic antigen of Schistosoma mansoni bind to small, defined oligosaccharide ...

    ID: 1853242

    Description: epitope description:beta-D-GalpNAc-(1->6)-[beta-D-GlcpA-(1->3)]-beta-D-GalpNAc-(1->6)-[beta-D-GlcpA-(1->3)]-beta-D-GalpNAc antigen name:proteoglycan h...

    Publication: 12695908;

  22. Immunodiagnostically applicable monoclonal antibodies to the circulating anodic antigen of Schistosoma mansoni bind to small, defined oligosaccharide ...

    ID: 1853243

    Description: epitope description:beta-D-GalpNAc-(1->6)-[beta-D-GlcpA-(1->3)]-beta-D-GalpNAc-(1->6)-[beta-D-GlcpA-(1->3)]-beta-D-GalpNAc antigen name:proteoglycan h...

    Publication: 12695908;

  23. Novel biomarker of HTLV-1-associated disease: specific appearance of antibody recognizing the receptor-binding site on HTLV-1 envelope protein.

    ID: 1853383

    Description: epitope description:EHVLTPSTSWTTKILKFIQL antigen name:Envelope glycoprotein gp63 host organism:Homo sapiens

    Publication: 15504252;

  24. Development and preliminary clinical evaluation of a peptide immunotherapy vaccine for cat allergy.

    ID: 1853399

    Description: epitope description:RILKNCVDAKMTEEDKE antigen name:Other Felis catus (cat) protein host organism:Homo sapiens

    Publication: 21211644;

  25. Serological and chemical specificities of twelve monoclonal anti-Lea and anti-Leb antibodies.

    ID: 1853436

    Description: epitope description:beta-D-Galp-(1->3)-[alpha-L-Fucp-(1->4)]-beta-D-GlcpNAc host organism:Mus musculus antibody name:78FR2.3, 069

    Publication: 1609521;

  26. Serological and chemical specificities of twelve monoclonal anti-Lea and anti-Leb antibodies.

    ID: 1853440

    Description: epitope description:beta-D-Galp-(1->3)-beta-D-GlcpNAc host organism:Mus musculus antibody name:101D9

    Publication: 1609521;

  27. Serological and chemical specificities of twelve monoclonal anti-Lea and anti-Leb antibodies.

    ID: 1853482

    Description: epitope description:alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-[alpha-L-Fucp-(1->4)]-beta-D-GlcpNAc host organism:Mus musculus antibody name:2F11

    Publication: 1609521;

  28. Serological and chemical specificities of twelve monoclonal anti-Lea and anti-Leb antibodies.

    ID: 1853486

    Description: epitope description:beta-D-Galp-(1->3)-[alpha-Neup5Ac-(2->6)]-alpha-D-GalpNAc host organism:Mus musculus antibody name:78FR2.3, 069, 101D9

    Publication: 1609521;

  29. Serological and chemical specificities of twelve monoclonal anti-Lea and anti-Leb antibodies.

    ID: 1853493

    Description: epitope description:alpha-L-Fucp-(1->2)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-D-GlcpNAc host organism:Mus musculus antibody name:076, 075, 96FR2.10...

    Publication: 1609521;

  30. Serological and chemical specificities of twelve monoclonal anti-Lea and anti-Leb antibodies.

    ID: 1853497

    Description: epitope description:alpha-L-Fucp-(1->2)-beta-D-Galp-(1->4)-beta-D-Glcp host organism:Mus musculus antibody name:076, 075

    Publication: 1609521;

  31. Serological and chemical specificities of twelve monoclonal anti-Lea and anti-Leb antibodies.

    ID: 1853498

    Description: epitope description:alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-beta-D-Galp host organism:Mus musculus antibody name:076, 075

    Publication: 1609521;

  32. Serological and chemical specificities of twelve monoclonal anti-Lea and anti-Leb antibodies.

    ID: 1853505

    Description: epitope description:alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-D-GlcpNAc host organism:Mus musculus antibody name:2F11

    Publication: 1609521;

  33. Serological and chemical specificities of twelve monoclonal anti-Lea and anti-Leb antibodies.

    ID: 1853507

    Description: epitope description:alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-beta-D-GalpNAc host organism:Mus musculus antibody name:2F11

    Publication: 1609521;

  34. High throughput monitoring of amyloid-beta(42) assembly into soluble oligomers achieved by sensitive conformation state-dependent immunoassays.

    ID: 1853512

    Description: epitope description:DAEFRHDSGYEVHHQKL antigen name:Amyloid beta A4 protein host organism:Mus musculus antibody name:6E10

    Publication: 21483096;

  35. Characterization of a branched lipopeptide candidate vaccine against influenza A/Puerto Rico 8/34 which is recognized by human B and T-cell immune res...

    ID: 1853578

    Description: epitope description:WLTEKEGSYP antigen name:Hemagglutinin host organism:Ovis aries

    Publication: 21679444;

  36. Closed headpiece of integrin alphaIIbbeta3 and its complex with an alphaIIbbeta3-specific antagonist that does not induce opening.

    ID: 1853589

    Description: epitope description:R108, N109, V110, G111, S112, Q113, L115, N180, I185, N189, S236, S237, R239, P240, G241, I242, L244, W245, H246 antigen name:Inte...

    Publication: 20679525;

  37. Sequence changes at the V-D junction of the VH1 heavy chain of anti-phosphocholine antibodies alter binding to and protection against Streptococcus pn...

    ID: 1853601

    Description: epitope description:p-nitrophenylphosphocholine host organism:Mus musculus CBA/CaHN-Btkxid/J antibody name:24.1B10

    Publication: 9184912;

  38. Sequence changes at the V-D junction of the VH1 heavy chain of anti-phosphocholine antibodies alter binding to and protection against Streptococcus pn...

    ID: 1853616

    Description: epitope description:phosphocholine host organism:Mus musculus CBA/CaHN-Btkxid/J antibody name:31-34-2

    Publication: 9184912;

  39. Sequence changes at the V-D junction of the VH1 heavy chain of anti-phosphocholine antibodies alter binding to and protection against Streptococcus pn...

    ID: 1853621

    Description: epitope description:phosphocholine host organism:Mus musculus CBA/CaHN-Btkxid/J antibody name:32-17-1

    Publication: 9184912;

  40. Sequence changes at the V-D junction of the VH1 heavy chain of anti-phosphocholine antibodies alter binding to and protection against Streptococcus pn...

    ID: 1853627

    Description: epitope description:6-(O-phosphocholine)oxyhexanoate host organism:Mus musculus CBA/CaHN-Btkxid/J antibody name:31-34-2

    Publication: 9184912;

  41. Synthesis and immunochemical characterization of S-linked glycoconjugate vaccines against Candida albicans.

    ID: 1853637

    Description: epitope description:beta-D-mannopyranosyl-(1->2)-beta-D-mannopyranosyl-(1->2)-beta-D-mannopyranosyl group antigen name:mannan host organism:Oryctolagu...

    Publication: 18543264;

  42. Synthesis and immunochemical characterization of S-linked glycoconjugate vaccines against Candida albicans.

    ID: 1853638

    Description: epitope description:propyl beta-D-mannopyranosyl-(1->2)-beta-D-mannopyranosyl-(1->2)-2-thio-beta-D-mannopyranoside host organism:Oryctolagus cuniculus...

    Publication: 18543264;

  43. A retro-inverso peptide analogue of influenza virus hemagglutinin B-cell epitope 91-108 induces a strong mucosal and systemic immune response and conf...

    ID: 1853658

    Description: epitope description:LSAYDPVDYPYSNSFAKC + D-aa(L1, S2, A3, Y4, D5, P6, V7, D8, Y9, P10, Y11, S12, N13, S14, F15, A16, K17, C18) host organism:Mus muscu...

    Publication: 12220890;

  44. A retro-inverso peptide analogue of influenza virus hemagglutinin B-cell epitope 91-108 induces a strong mucosal and systemic immune response and conf...

    ID: 1853666

    Description: epitope description:CKAFSNSYPYDVPDYASL + ACET(C1) host organism:Mus musculus BALB/c

    Publication: 12220890;

  45. A retro-inverso peptide analogue of influenza virus hemagglutinin B-cell epitope 91-108 induces a strong mucosal and systemic immune response and conf...

    ID: 1853669

    Description: epitope description:CKAFSNSYPYDVPDYASL + ACET(C1) host organism:Mus musculus BALB/c

    Publication: 12220890;

  46. Structure-function relationships of the antigenicity of mycolic acids in tuberculosis patients.

    ID: 1853677

    Description: epitope description:(2R)-2-{(1R)-1-hydroxy-12-[(1R,2S)-2-{14-[(1R,2S)-2-icosylcyclopropyl]tetradecyl}cyclopropyl]dodecyl}hexacosanoic acid host organi...

    Publication: 20875402;

  47. Structure-function relationships of the antigenicity of mycolic acids in tuberculosis patients.

    ID: 1853680

    Description: epitope description:(2R)-2-{(1R)-1-hydroxy-16-[(1R,2S)-2-(20-methyl-19-oxooctatriacontyl)cyclopropyl]hexadecyl}hexacosanoic acid host organism:Homo sa...

    Publication: 20875402;

  48. Structure-function relationships of the antigenicity of mycolic acids in tuberculosis patients.

    ID: 1853681

    Description: epitope description:(2R)-2-[(1R)-1-hydroxy-16-{(1S,2R)-2-[(20S)-20-methyl-19-oxooctatriacontyl]cyclopropyl}hexadecyl]hexacosanoic acid host organism:H...

    Publication: 20875402;

  49. Structure-function relationships of the antigenicity of mycolic acids in tuberculosis patients.

    ID: 1853684

    Description: epitope description:(2R)-2-[(1R)-1-hydroxy-18-{(1R,2S)-2-[(17R,18R)-17-methoxy-18-methylhexatriacontyl]cyclopropyl}octadecyl]hexacosanoic acid host or...

    Publication: 20875402;

  50. Structure-function relationships of the antigenicity of mycolic acids in tuberculosis patients.

    ID: 1853689

    Description: epitope description:(2R)-2-[(1R)-1-hydroxy-16-{(1R,2S)-2-[(20S)-20-methyl-19-oxooctatriacontyl]cyclopropyl}hexadecyl]hexacosanoic acid host organism:H...

    Publication: 20875402;

  51. Structure-function relationships of the antigenicity of mycolic acids in tuberculosis patients.

    ID: 1853691

    Description: epitope description:(2R)-2-[(1R)-1-hydroxy-17-{(1R,2R)-2-[(2R,21R,22R)-21-hydroxy-22-methyltetracontan-2-yl]cyclopropyl}heptadecyl]hexacosanoic acid h...

    Publication: 20875402;

  52. Myosin-cross-reactive epitope of Shigella flexneri invasion plasmid antigen B.

    ID: 1853700

    Description: epitope description:LTNKITAWKSQQ antigen name:Invasin IpaB host organism:Mus musculus BALB/c antibody name:2F1

    Publication: 1370431;

  53. Unusual water-mediated antigenic recognition of the proinflammatory cytokine interleukin-18.

    ID: 1853705

    Description: epitope description:L51, P93, R140, P143, G144, H145, K148, E152, E157, F160, K176, E177, D178, E179, L180, G181, D182, R183, M186 antigen name:Interl...

    Publication: 19553661;

  54. Unusual water-mediated antigenic recognition of the proinflammatory cytokine interleukin-18.

    ID: 1853706

    Description: epitope description:L51, P93, R140, P143, G144, H145, K148, E152, E157, F160, K176, E177, D178, E179, L180, G181, D182, R183, M186 antigen name:Interl...

    Publication: 19553661;

  55. Plasmodium falciparum merozoite surface protein 6 displays multiple targets for naturally occurring antibodies that mediate monocyte-dependent parasit...

    ID: 1853708

    Description: epitope description:LLEQIKIPSWDRNNIPDENEQVIEDPQEDNKDEDEDEETETENLETEDDNNEE antigen name:Merozoite surface protein 6 host organism:Homo sapiens

    Publication: 15664972;

  56. Plasmodium falciparum merozoite surface protein 6 displays multiple targets for naturally occurring antibodies that mediate monocyte-dependent parasit...

    ID: 1853710

    Description: epitope description:LLEQIKIPSWDRNNIPDENEQVIEDPQEDNKDEDEDEETETENLETEDDNNEE antigen name:Merozoite surface protein 6 host organism:Homo sapiens

    Publication: 15664972;

  57. Plasmodium falciparum merozoite surface protein 6 displays multiple targets for naturally occurring antibodies that mediate monocyte-dependent parasit...

    ID: 1853713

    Description: epitope description:NLISNKNKKNDETKKTAENIVKTLVGLFNEKNEIDSTINNLVQEMIHLFSNN antigen name:Merozoite surface protein 6 host organism:Homo sapiens

    Publication: 15664972;

  58. A peptide mimotope of type 8 pneumococcal capsular polysaccharide induces a protective immune response in mice.

    ID: 1853714

    Description: epitope description:FHLPYNHNWFAL host organism:Mus musculus BALB/c

    Publication: 15618169;

  59. Myosin-cross-reactive epitope of Shigella flexneri invasion plasmid antigen B.

    ID: 1853774

    Description: epitope description:LTNKITAWKSQQ antigen name:Invasin IpaB host organism:Mus musculus BALB/c antibody name:2F1

    Publication: 1370431;

  60. Phage display identifies two Caprine Arthritis Encephalitis Virus env epitopes.

    ID: 1853775

    Description: epitope description:SSKVYTPTGSLP host organism:Capra hircus

    Publication: 21781322;

  61. Phage display identifies two Caprine Arthritis Encephalitis Virus env epitopes.

    ID: 1853779

    Description: epitope description:FPGAAGSNRSPL host organism:Capra hircus

    Publication: 21781322;

  62. Phage display identifies two Caprine Arthritis Encephalitis Virus env epitopes.

    ID: 1853784

    Description: epitope description:TLSWGLGSIRTA host organism:Capra hircus

    Publication: 21781322;

  63. Phage display identifies two Caprine Arthritis Encephalitis Virus env epitopes.

    ID: 1853785

    Description: epitope description:AEYSMYSAHRPR host organism:Capra hircus

    Publication: 21781322;

  64. Phage display identifies two Caprine Arthritis Encephalitis Virus env epitopes.

    ID: 1853789

    Description: epitope description:ATEIIPIALSRP host organism:Capra hircus

    Publication: 21781322;

  65. Phage display identifies two Caprine Arthritis Encephalitis Virus env epitopes.

    ID: 1853794

    Description: epitope description:TKLSHKN host organism:Capra hircus

    Publication: 21781322;

  66. Phage display identifies two Caprine Arthritis Encephalitis Virus env epitopes.

    ID: 1853799

    Description: epitope description:YNRAMIG host organism:Capra hircus

    Publication: 21781322;

  67. Phage display identifies two Caprine Arthritis Encephalitis Virus env epitopes.

    ID: 1853801

    Description: epitope description:SGKFYPV host organism:Capra hircus

    Publication: 21781322;

  68. Phage display identifies two Caprine Arthritis Encephalitis Virus env epitopes.

    ID: 1853807

    Description: epitope description:SWNHWSY host organism:Capra hircus

    Publication: 21781322;

  69. Phage display identifies two Caprine Arthritis Encephalitis Virus env epitopes.

    ID: 1853811

    Description: epitope description:SWKHWSY host organism:Capra hircus

    Publication: 21781322;

  70. Schistosoma mansoni-infected mice produce antibodies that cross-react with plant, insect, and mammalian glycoproteins and recognize the truncated bian...

    ID: 1853899

    Description: epitope description:alpha-D-Manp-(1->3)-[alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-D-GlcpNAc antigen name:glycoprotein host organi...

    Publication: 12626421;

  71. Schistosoma mansoni-infected mice produce antibodies that cross-react with plant, insect, and mammalian glycoproteins and recognize the truncated bian...

    ID: 1853900

    Description: epitope description:alpha-D-Manp-(1->3)-[alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-D-GlcpNAc antigen name:glycoprotein host organi...

    Publication: 12626421;

  72. Schistosoma mansoni-infected mice produce antibodies that cross-react with plant, insect, and mammalian glycoproteins and recognize the truncated bian...

    ID: 1853905

    Description: epitope description:alpha-D-Manp-(1->3)-[alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-D-GlcpNAc antigen name:glycoprotein host organi...

    Publication: 12626421;

  73. Schistosoma mansoni-infected mice produce antibodies that cross-react with plant, insect, and mammalian glycoproteins and recognize the truncated bian...

    ID: 1853906

    Description: epitope description:alpha-D-Manp-(1->3)-[alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-D-GlcpNAc antigen name:glycoprotein host organi...

    Publication: 12626421;

  74. Schistosoma mansoni-infected mice produce antibodies that cross-react with plant, insect, and mammalian glycoproteins and recognize the truncated bian...

    ID: 1853907

    Description: epitope description:alpha-D-Manp-(1->3)-[alpha-D-Manp-(1->6)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-D-GlcpNAc antigen name:glycoprotein host organi...

    Publication: 12626421;

  75. Epitope analysis of monoclonal antibody E5/G6, which binds to a linear epitope in the nucleocapsid protein of hantaviruses.

    ID: 1853924

    Description: epitope description:YEDVNGIRK antigen name:Seoul orthohantavirus protein host organism:Mus musculus BALB/c antibody name:E5/G6

    Publication: 15338326;

  76. Epitope analysis of monoclonal antibody E5/G6, which binds to a linear epitope in the nucleocapsid protein of hantaviruses.

    ID: 1853934

    Description: epitope description:YEDVNGIRK antigen name:Seoul orthohantavirus protein host organism:Mus musculus BALB/c antibody name:E5/G6

    Publication: 15338326;

  77. Epitope analysis of monoclonal antibody E5/G6, which binds to a linear epitope in the nucleocapsid protein of hantaviruses.

    ID: 1853935

    Description: epitope description:YEDVNGIRK antigen name:Seoul orthohantavirus protein host organism:Mus musculus BALB/c antibody name:E5/G6

    Publication: 15338326;

  78. Epitope analysis of monoclonal antibody E5/G6, which binds to a linear epitope in the nucleocapsid protein of hantaviruses.

    ID: 1853937

    Description: epitope description:YEDVNGIRK antigen name:Seoul orthohantavirus protein host organism:Mus musculus BALB/c antibody name:E5/G6

    Publication: 15338326;

  79. Epitope analysis of monoclonal antibody E5/G6, which binds to a linear epitope in the nucleocapsid protein of hantaviruses.

    ID: 1853939

    Description: epitope description:YEDVNGIRK antigen name:Seoul orthohantavirus protein host organism:Mus musculus BALB/c antibody name:E5/G6

    Publication: 15338326;

  80. An epitope conserved in orthopoxvirus A13 envelope protein is the target of neutralizing and protective antibodies.

    ID: 1853965

    Description: epitope description:ISSLYNLVKSS antigen name:Virion membrane protein A13 host organism:Mus musculus BALB/c antibody name:11F7

    Publication: 21810533;

  81. An epitope conserved in orthopoxvirus A13 envelope protein is the target of neutralizing and protective antibodies.

    ID: 1853967

    Description: epitope description:ISSLYNLVKSS antigen name:Virion membrane protein A13 host organism:Mus musculus BALB/c antibody name:11F7

    Publication: 21810533;

  82. An epitope conserved in orthopoxvirus A13 envelope protein is the target of neutralizing and protective antibodies.

    ID: 1853970

    Description: epitope description:ISSLYNLVKSS antigen name:Virion membrane protein A13 host organism:Mus musculus BALB/c antibody name:11F7

    Publication: 21810533;

  83. Asp159 is a critical core amino acid of an IgE-binding and cross-reactive epitope of a dust mite allergen Der f 7.

    ID: 1853993

    Description: epitope description:AAIEQSETIDPMKVP antigen name:Der f 7 host organism:Homo sapiens

    Publication: 21820178;

  84. Asp159 is a critical core amino acid of an IgE-binding and cross-reactive epitope of a dust mite allergen Der f 7.

    ID: 1853996

    Description: epitope description:KGELAMRNIEARGLK antigen name:Der f 7 host organism:Homo sapiens

    Publication: 21820178;

  85. Asp159 is a critical core amino acid of an IgE-binding and cross-reactive epitope of a dust mite allergen Der f 7.

    ID: 1853997

    Description: epitope description:ARGLKQMKRQGDANV antigen name:Der f 7 host organism:Homo sapiens

    Publication: 21820178;

  86. Asp159 is a critical core amino acid of an IgE-binding and cross-reactive epitope of a dust mite allergen Der f 7.

    ID: 1853998

    Description: epitope description:GDANVKGEEGIVKAH antigen name:Der f 7 host organism:Homo sapiens

    Publication: 21820178;

  87. Asp159 is a critical core amino acid of an IgE-binding and cross-reactive epitope of a dust mite allergen Der f 7.

    ID: 1854002

    Description: epitope description:TTHVISDIQDFVVAL antigen name:Der f 7 host organism:Homo sapiens

    Publication: 21820178;

  88. Asp159 is a critical core amino acid of an IgE-binding and cross-reactive epitope of a dust mite allergen Der f 7.

    ID: 1854009

    Description: epitope description:MTKVLAPAFKRELEK antigen name:Der f 7 host organism:Homo sapiens

    Publication: 21820178;

  89. A neutralizing antibody selected from plasma cells that binds to group 1 and group 2 influenza A hemagglutinins.

    ID: 1861903

    Description: epitope description:RKKRGLFGAIAGFIE antigen name:Hemagglutinin host organism:Homo sapiens

    Publication: 21798894;

  90. A neutralizing antibody selected from plasma cells that binds to group 1 and group 2 influenza A hemagglutinins.

    ID: 1861905

    Description: epitope description:KESTQKAIDGVTNKVNS antigen name:Hemagglutinin host organism:Homo sapiens

    Publication: 21798894;

  91. Serological specificity of phenolic glycolipid I from Mycobacterium leprae and use in serodiagnosis of leprosy.

    ID: 1861912

    Description: epitope description:4-(18,20-dihydroxy-26-methoxy-25-methyloctacosyl)phenyl 3,6-di-O-methyl-beta-D-Glc-(1->4)-2,3-di-O-methyl-alpha-L-Rha-(1->2)-3-O-m...

    Publication: 6193065;

  92. A neutralizing antibody selected from plasma cells that binds to group 1 and group 2 influenza A hemagglutinins.

    ID: 1861934

    Description: epitope description:RKKRGLFGAIAGFIE antigen name:Hemagglutinin host organism:Homo sapiens antibody name:F16

    Publication: 21798894;

  93. A neutralizing antibody selected from plasma cells that binds to group 1 and group 2 influenza A hemagglutinins.

    ID: 1862011

    Description: epitope description:RKKRGLFGAIAGFIE antigen name:Hemagglutinin host organism:Homo sapiens antibody name:F16

    Publication: 21798894;

  94. Antibody-mediated neutralization of cytomegalovirus: modulation of efficacy induced through the IgG constant region.

    ID: 1862013

    Description: epitope description:ANETIYNTTLKYGDVVGVNT antigen name:Envelope glycoprotein B host organism:Homo sapiens antibody name:ITC88

    Publication: 11922941;

  95. Structure-antigenicity relationship of peptides from the pre-S2 region of the hepatitis B virus surface antigen.

    ID: 1862052

    Description: epitope description:MQWNSTTFHQALLDPRVRGLYFPAGG antigen name:Large envelope protein host organism:Mus musculus antibody name:H8

    Publication: 7531533;

  96. Structure-antigenicity relationship of peptides from the pre-S2 region of the hepatitis B virus surface antigen.

    ID: 1862054

    Description: epitope description:MQWNSTTFHQTLQDPRVRGLYFPAGG antigen name:Large envelope protein host organism:Mus musculus antibody name:H8

    Publication: 7531533;

  97. A neutralizing antibody selected from plasma cells that binds to group 1 and group 2 influenza A hemagglutinins.

    ID: 1862057

    Description: epitope description:RKKRGLFGAIAGFIE antigen name:Hemagglutinin host organism:Homo sapiens antibody name:F16

    Publication: 21798894;

  98. A neutralizing antibody selected from plasma cells that binds to group 1 and group 2 influenza A hemagglutinins.

    ID: 1862059

    Description: epitope description:RKKRGLFGAIAGFIE antigen name:Hemagglutinin host organism:Homo sapiens antibody name:F16

    Publication: 21798894;

  99. A hypoallergenic cat vaccine based on Fel d 1-derived peptides fused to hepatitis B PreS.

    ID: 1862109

    Description: epitope description:MTTISSSKDCMGEAVQNTVEDLKLNTLGR antigen name:Major allergen I polypeptide chain 2 host organism:Homo sapiens

    Publication: 21411130;

  100. A neutralizing antibody selected from plasma cells that binds to group 1 and group 2 influenza A hemagglutinins.

    ID: 1862343

    Description: epitope description:RKKRGLFGAIAGFIE antigen name:Hemagglutinin host organism:Homo sapiens antibody name:F16

    Publication: 21798894;
Displaying 100 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston