Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. The murine B cell repertoire is severely selected against endogenous cellular prion protein.

    ID: 1347259

    Description: epitope description:MLGSAMSRPMIHFGNDWEDRYYRENMYRYP antigen name:Major prion protein host organism:Mus musculus C57BL/6 antibody name:wt anti-P8

    Publication: 16272297;

  2. The murine B cell repertoire is severely selected against endogenous cellular prion protein.

    ID: 1347270

    Description: epitope description:NQVYYRPVDQYSNQNNFVHDCVNITIKQHT antigen name:Major prion protein host organism:Mus musculus C57BL/6 antibody name:wt anti-P9

    Publication: 16272297;

  3. The murine B cell repertoire is severely selected against endogenous cellular prion protein.

    ID: 1347271

    Description: epitope description:NQVYYRPVDQYSNQNNFVHDCVNITIKQHT antigen name:Major prion protein host organism:Mus musculus PrP null antibody name:anti-P9

    Publication: 16272297;

  4. Synthetic peptide antigens of tetanus toxin.

    ID: 1347273

    Description: epitope description:GLVGTHNGQIGNDPNRDILIASNWYFNHLKDKILGCDWYFVPTDEGWTND antigen name:Tetanus toxin host organism:Mus musculus BALB/c

    Publication: 7935502;

  5. The murine B cell repertoire is severely selected against endogenous cellular prion protein.

    ID: 1347275

    Description: epitope description:NQVYYRPVDQYSNQNNFVHDCVNITIKQHT antigen name:Major prion protein host organism:Mus musculus PrP null antibody name:anti-P9

    Publication: 16272297;

  6. The murine B cell repertoire is severely selected against endogenous cellular prion protein.

    ID: 1347276

    Description: epitope description:NQVYYRPVDQYSNQNNFVHDCVNITIKQHT antigen name:Major prion protein host organism:Mus musculus C57BL/6 antibody name:wt anti-P9

    Publication: 16272297;

  7. The murine B cell repertoire is severely selected against endogenous cellular prion protein.

    ID: 1347278

    Description: epitope description:DWEDRYYRENMYRYPNQVYYRPVDQYSNQN antigen name:Major prion protein host organism:Mus musculus PrP null antibody name:anti-P8

    Publication: 16272297;

  8. The murine B cell repertoire is severely selected against endogenous cellular prion protein.

    ID: 1347285

    Description: epitope description:DWEDRYYRENMYRYPNQVYYRPVDQYSNQN antigen name:Major prion protein host organism:Mus musculus PrP null antibody name:anti-P8

    Publication: 16272297;

  9. The murine B cell repertoire is severely selected against endogenous cellular prion protein.

    ID: 1347305

    Description: epitope description:YPNQVYYRPVDQYSN antigen name:Major prion protein host organism:Mus musculus C57BL/6 antibody name:wt anti-P8

    Publication: 16272297;

  10. The murine B cell repertoire is severely selected against endogenous cellular prion protein.

    ID: 1347308

    Description: epitope description:DWEDRYYRENMYRYPNQVYYRPVDQYSNQN antigen name:Major prion protein host organism:Mus musculus PrP null antibody name:anti-P8

    Publication: 16272297;

  11. The murine B cell repertoire is severely selected against endogenous cellular prion protein.

    ID: 1347322

    Description: epitope description:DWEDRYYRENMYRYPNQVYYRPVDQYSNQN antigen name:Major prion protein host organism:Mus musculus PrP null antibody name:anti-P8

    Publication: 16272297;

  12. A surrogate hepatitis B virus antigenic epitope represented by a synthetic peptide and an internal image antiidiotype antibody.

    ID: 1347331

    Description: epitope description:CTKPTDGNC antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 2425029;

  13. A surrogate hepatitis B virus antigenic epitope represented by a synthetic peptide and an internal image antiidiotype antibody.

    ID: 1347335

    Description: epitope description:CTKPTDGNC antigen name:Large envelope protein host organism:Capra hircus

    Publication: 2425029;

  14. A surrogate hepatitis B virus antigenic epitope represented by a synthetic peptide and an internal image antiidiotype antibody.

    ID: 1347337

    Description: epitope description:CTKPTDGNC antigen name:Large envelope protein host organism:Cavia porcellus

    Publication: 2425029;

  15. The cellular location of a foreign B cell epitope expressed by recombinant bacteria determines its T cell-independent or T cell-dependent characterist...

    ID: 1347356

    Description: epitope description:QDPRVRGLYFPAGG antigen name:Large envelope protein host organism:Mus musculus BALB/c

    Publication: 1719080;

  16. Lipooligosaccharidic antigens from Mycobacterium kansasii and Mycobacterium gastri.

    ID: 1352136

    Description: epitope description:3,6-dideoxy-4-C-(1,3-dimethoxy-4,5,6,7-tetrahydroxyheptyl)-alpha-D-xylo-hexp-(1->3)-beta-L-Xylp antigen name:lipooligosaccharide h...

    Publication: 7496145;

  17. Analysis of B-cell epitopes in the variable C-terminal region of the Mycobacterium leprae 70-kilodalton heat shock protein.

    ID: 1352189

    Description: epitope description:IYEATQAASKVGGEASAPGGSNSTD antigen name:Chaperone protein DnaK host organism:Homo sapiens

    Publication: 7678097;

  18. Analysis of B-cell epitopes in the variable C-terminal region of the Mycobacterium leprae 70-kilodalton heat shock protein.

    ID: 1352190

    Description: epitope description:AMEKLGQDSQALGQAIYEATQAASK antigen name:Chaperone protein DnaK host organism:Mus musculus C57BL/6

    Publication: 7678097;

  19. Analysis of B-cell epitopes in the variable C-terminal region of the Mycobacterium leprae 70-kilodalton heat shock protein.

    ID: 1352191

    Description: epitope description:AMEKLGQDSQALGQAIYEATQAASK antigen name:Chaperone protein DnaK host organism:Oryctolagus cuniculus

    Publication: 7678097;

  20. Analysis of B-cell epitopes in the variable C-terminal region of the Mycobacterium leprae 70-kilodalton heat shock protein.

    ID: 1352192

    Description: epitope description:AMEKLGQDSQALGQAIYEATQAASK antigen name:Chaperone protein DnaK host organism:Homo sapiens

    Publication: 7678097;

  21. Analysis of B-cell epitopes in the variable C-terminal region of the Mycobacterium leprae 70-kilodalton heat shock protein.

    ID: 1352200

    Description: epitope description:VPEDTLNKVEAAVAEAKTALGGTDI antigen name:Chaperone protein DnaK host organism:Oryctolagus cuniculus

    Publication: 7678097;

  22. Analysis of B-cell epitopes in the variable C-terminal region of the Mycobacterium leprae 70-kilodalton heat shock protein.

    ID: 1352201

    Description: epitope description:VPEDTLNKVEAAVAEAKTALGGTDI antigen name:Chaperone protein DnaK host organism:Homo sapiens

    Publication: 7678097;

  23. Analysis of B-cell epitopes in the variable C-terminal region of the Mycobacterium leprae 70-kilodalton heat shock protein.

    ID: 1352205

    Description: epitope description:EKFVKEQRETENGSRVPEDTLNKVE antigen name:Chaperone protein DnaK host organism:Homo sapiens

    Publication: 7678097;

  24. Analysis of B-cell epitopes in the variable C-terminal region of the Mycobacterium leprae 70-kilodalton heat shock protein.

    ID: 1352206

    Description: epitope description:EKFVKEQRETENGSRVPEDTLNKVE antigen name:Chaperone protein DnaK host organism:Oryctolagus cuniculus

    Publication: 7678097;

  25. Analysis of B-cell epitopes in the variable C-terminal region of the Mycobacterium leprae 70-kilodalton heat shock protein.

    ID: 1352209

    Description: epitope description:EEADVRNQAETLVYQTEKFVKEQRETE antigen name:Chaperone protein DnaK host organism:Oryctolagus cuniculus

    Publication: 7678097;

  26. Analysis of B-cell epitopes in the variable C-terminal region of the Mycobacterium leprae 70-kilodalton heat shock protein.

    ID: 1352219

    Description: epitope description:AEEDRKRREEADVRNQAE antigen name:Chaperone protein DnaK host organism:Oryctolagus cuniculus

    Publication: 7678097;

  27. Analysis of B-cell epitopes in the variable C-terminal region of the Mycobacterium leprae 70-kilodalton heat shock protein.

    ID: 1352220

    Description: epitope description:AEEDRKRREEADVRNQAE antigen name:Chaperone protein DnaK host organism:Homo sapiens

    Publication: 7678097;

  28. Structural and functional characterization of a monoclonal antibody specific for the preS1 region of hepatitis B virus.

    ID: 1352244

    Description: epitope description:NTANPDW antigen name:Large envelope protein host organism:Mus musculus BALB/c antibody name:5a19

    Publication: 11749974;

  29. Epitope mapping of the Mycobacterium bovis secretory protein MPB70 using overlapping peptide analysis.

    ID: 1352245

    Description: epitope description:ANVVGTRQ antigen name:Immunogenic protein MPB70 host organism:Mus musculus antibody name:SB9

    Publication: 1691265;

  30. Structural and functional characterization of a monoclonal antibody specific for the preS1 region of hepatitis B virus.

    ID: 1352249

    Description: epitope description:NTANPDW antigen name:Large envelope protein host organism:Mus musculus BALB/c antibody name:5a19

    Publication: 11749974;

  31. Behavior of a short preS1 epitope on the surface of hepatitis B core particles.

    ID: 1352251

    Description: epitope description:DPAFR antigen name:Large envelope protein host organism:Mus musculus BALB/c antibody name:MA-18/7

    Publication: 10223334;

  32. Epitope mapping of twelve monoclonal antibodies against the phenolic glycolipid-I of M. leprae.

    ID: 1352283

    Description: epitope description:beta-D-Glcp3,6Me2-(1->4)-alpha-L-Rhap2,3-Me2 antigen name:phenolic glycolipid-1 host organism:Mus musculus antibody name:1-21, 1-2...

    Publication: 9465158;

  33. Epitope mapping of twelve monoclonal antibodies against the phenolic glycolipid-I of M. leprae.

    ID: 1352284

    Description: epitope description:beta-D-Glcp3,6Me2-(1->4)-alpha-L-Rhap2,3-Me2 antigen name:phenolic glycolipid-1 host organism:Mus musculus antibody name:6A12, 8A2...

    Publication: 9465158;

  34. Epitope mapping of the Mycobacterium bovis secretory protein MPB70 using overlapping peptide analysis.

    ID: 1352309

    Description: epitope description:NVVGTRQ antigen name:Immunogenic protein MPB70 host organism:Bos taurus antibody name:Cow serum

    Publication: 1691265;

  35. Epitope mapping of the Mycobacterium bovis secretory protein MPB70 using overlapping peptide analysis.

    ID: 1352311

    Description: epitope description:SNNPE antigen name:Immunogenic protein MPB70 host organism:Bos taurus antibody name:Cow serum

    Publication: 1691265;

  36. Antibodies against different epitopes of heat-shock protein 60 in children with type 1 diabetes mellitus.

    ID: 1352314

    Description: epitope description:VIIEQSWGSP antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens

    Publication: 11803047;

  37. Antibodies against different epitopes of heat-shock protein 60 in children with type 1 diabetes mellitus.

    ID: 1352317

    Description: epitope description:TVLARSIAKE antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens

    Publication: 11803047;

  38. Antibodies against different epitopes of heat-shock protein 60 in children with type 1 diabetes mellitus.

    ID: 1352320

    Description: epitope description:SKGANPVEIR antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens

    Publication: 11803047;

  39. Antibodies against different epitopes of heat-shock protein 60 in children with type 1 diabetes mellitus.

    ID: 1352324

    Description: epitope description:ATISANGDKE antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens

    Publication: 11803047;

  40. Epitope mapping of the Mycobacterium bovis secretory protein MPB70 using overlapping peptide analysis.

    ID: 1352346

    Description: epitope description:LKTNSSLL antigen name:Immunogenic protein MPB70 host organism:Bos taurus antibody name:Cow serum

    Publication: 1691265;

  41. Epitope mapping of the Mycobacterium bovis secretory protein MPB70 using overlapping peptide analysis.

    ID: 1352348

    Description: epitope description:PQVNLVDT antigen name:Immunogenic protein MPB70 host organism:Bos taurus antibody name:Cow serum

    Publication: 1691265;

  42. Antibodies against different epitopes of heat-shock protein 60 in children with type 1 diabetes mellitus.

    ID: 1352366

    Description: epitope description:ASLLTTAEVV antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens

    Publication: 11803047;

  43. Epitope mapping of the Mycobacterium bovis secretory protein MPB70 using overlapping peptide analysis.

    ID: 1352368

    Description: epitope description:DLVGPGCA antigen name:Immunogenic protein MPB70 host organism:Bos taurus antibody name:Cow serum

    Publication: 1691265;

  44. Epitope mapping of the Mycobacterium bovis secretory protein MPB70 using overlapping peptide analysis.

    ID: 1352370

    Description: epitope description:VGPGCAEY antigen name:Immunogenic protein MPB70 host organism:Bos taurus antibody name:Cow serum

    Publication: 1691265;

  45. Epitope mapping of the Mycobacterium bovis secretory protein MPB70 using overlapping peptide analysis.

    ID: 1352375

    Description: epitope description:EYAAANPT antigen name:Immunogenic protein MPB70 host organism:Bos taurus antibody name:Cow serum

    Publication: 1691265;

  46. Epitope mapping of the Mycobacterium bovis secretory protein MPB70 using overlapping peptide analysis.

    ID: 1352377

    Description: epitope description:AAANPTGP antigen name:Immunogenic protein MPB70 host organism:Bos taurus antibody name:Cow serum

    Publication: 1691265;

  47. Epitope mapping of the Mycobacterium bovis secretory protein MPB70 using overlapping peptide analysis.

    ID: 1352379

    Description: epitope description:ANPTGPAS antigen name:Immunogenic protein MPB70 host organism:Bos taurus antibody name:Cow serum

    Publication: 1691265;

  48. Epitope mapping of the Mycobacterium bovis secretory protein MPB70 using overlapping peptide analysis.

    ID: 1352382

    Description: epitope description:TGPASVQG antigen name:Immunogenic protein MPB70 host organism:Bos taurus antibody name:Cow serum

    Publication: 1691265;

  49. Epitope mapping of the Mycobacterium bovis secretory protein MPB70 using overlapping peptide analysis.

    ID: 1352385

    Description: epitope description:ASVQGMSQ antigen name:Immunogenic protein MPB70 host organism:Bos taurus antibody name:Cow serum

    Publication: 1691265;

  50. Antibodies against different epitopes of heat-shock protein 60 in children with type 1 diabetes mellitus.

    ID: 1352386

    Description: epitope description:KVTLGPKGRN antigen name:60 kDa chaperonin 2 host organism:Homo sapiens

    Publication: 11803047;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston