Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Identification of hepatitis B virus core protein regions exposed or internalized at the surface of HBcAg particles by scanning with monoclonal antibod...

    ID: 1352794

    Description: epitope description:GATVELLSFLP antigen name:Capsid protein host organism:Mus musculus antibody name:10E11

    Publication: 8030252;

  2. Epitope mapping of immunogenic and adhesive structures in repetitive domains of Mycoplasma bovis variable surface lipoproteins.

    ID: 1352799

    Description: epitope description:GNDLGKVQVA antigen name:Variable surface lipoprotein, VspF host organism:Mus musculus antibody name:1E5

    Publication: 10639433;

  3. Epitope mapping of immunogenic and adhesive structures in repetitive domains of Mycoplasma bovis variable surface lipoproteins.

    ID: 1352803

    Description: epitope description:GTGA antigen name:Variable surface lipoprotein, VspF host organism:Mus musculus antibody name:1E5

    Publication: 10639433;

  4. Epitope mapping of immunogenic and adhesive structures in repetitive domains of Mycoplasma bovis variable surface lipoproteins.

    ID: 1352806

    Description: epitope description:TPGENK antigen name:Variable surface lipoprotein, VspA host organism:Mus musculus antibody name:4D7

    Publication: 10639433;

  5. Epitope mapping of immunogenic and adhesive structures in repetitive domains of Mycoplasma bovis variable surface lipoproteins.

    ID: 1352812

    Description: epitope description:KPEENK antigen name:Variable surface lipoprotein, VspA host organism:Mus musculus antibody name:4D7

    Publication: 10639433;

  6. Epitope mapping of immunogenic and adhesive structures in repetitive domains of Mycoplasma bovis variable surface lipoproteins.

    ID: 1352814

    Description: epitope description:NKKP antigen name:Variable surface lipoprotein, VspA host organism:Mus musculus antibody name:2A8

    Publication: 10639433;

  7. Epitope mapping of immunogenic and adhesive structures in repetitive domains of Mycoplasma bovis variable surface lipoproteins.

    ID: 1352815

    Description: epitope description:NKKP antigen name:Variable surface lipoprotein, VspA host organism:Mus musculus antibody name:2A8

    Publication: 10639433;

  8. Epitope mapping of immunogenic and adhesive structures in repetitive domains of Mycoplasma bovis variable surface lipoproteins.

    ID: 1352818

    Description: epitope description:SETLKS antigen name:Variable surface lipoprotein, VspF host organism:Mus musculus antibody name:2A8

    Publication: 10639433;

  9. Identification of hepatitis B virus core protein regions exposed or internalized at the surface of HBcAg particles by scanning with monoclonal antibod...

    ID: 1352820

    Description: epitope description:PPNAPILSTLPE antigen name:Capsid protein host organism:Mus musculus antibody name:10C6

    Publication: 8030252;

  10. Epitope mapping of immunogenic and adhesive structures in repetitive domains of Mycoplasma bovis variable surface lipoproteins.

    ID: 1352822

    Description: epitope description:KVPTL antigen name:Variable surface lipoprotein, VspF host organism:Mus musculus antibody name:2A8

    Publication: 10639433;

  11. Epitope mapping of immunogenic and adhesive structures in repetitive domains of Mycoplasma bovis variable surface lipoproteins.

    ID: 1352823

    Description: epitope description:KVPTL antigen name:Variable surface lipoprotein, VspF host organism:Mus musculus antibody name:2A8

    Publication: 10639433;

  12. Epitope mapping of immunogenic and adhesive structures in repetitive domains of Mycoplasma bovis variable surface lipoproteins.

    ID: 1352824

    Description: epitope description:KSVTV antigen name:Variable surface lipoprotein, VspF host organism:Mus musculus antibody name:2A8

    Publication: 10639433;

  13. Identification of hepatitis B virus core protein regions exposed or internalized at the surface of HBcAg particles by scanning with monoclonal antibod...

    ID: 1352837

    Description: epitope description:RPPNAP antigen name:Capsid protein host organism:Mus musculus antibody name:HBeOT7Q, HBeOT6P

    Publication: 8030252;

  14. Importance of subtype in the immune response to the pre-S(2) region of the hepatitis B surface antigen. II. Synthetic Pre-S(2) immunogen.

    ID: 1352856

    Description: epitope description:DPRVRGLYLPA antigen name:Large envelope protein host organism:Mus musculus C3H.Q

    Publication: 1691763;

  15. Importance of subtype in the immune response to the pre-S(2) region of the hepatitis B surface antigen. II. Synthetic Pre-S(2) immunogen.

    ID: 1352888

    Description: epitope description:NIASHISSISARTGDPVTN antigen name:Large envelope protein host organism:Mus musculus C57BL/10

    Publication: 1691763;

  16. Identification of hepatitis B virus core protein regions exposed or internalized at the surface of HBcAg particles by scanning with monoclonal antibod...

    ID: 1352924

    Description: epitope description:DPISRD antigen name:Capsid protein host organism:Mus musculus antibody name:C1-5

    Publication: 8030252;

  17. Identification of hepatitis B virus core protein regions exposed or internalized at the surface of HBcAg particles by scanning with monoclonal antibod...

    ID: 1352926

    Description: epitope description:LEDPISRDL antigen name:Capsid protein host organism:Mus musculus antibody name:35/312

    Publication: 8030252;

  18. Recognition of Mycobacterium leprae recombinant 18,000 MW epitopes by IgG subclasses in leprosy.

    ID: 1352966

    Description: epitope description:MLMRTDPFRELDRFA antigen name:UniProt:B8ZS71 host organism:Homo sapiens

    Publication: 7538491;

  19. Recognition of Mycobacterium leprae recombinant 18,000 MW epitopes by IgG subclasses in leprosy.

    ID: 1352967

    Description: epitope description:MLMRTDPFRELDRFA antigen name:UniProt:B8ZS71 host organism:Homo sapiens

    Publication: 7538491;

  20. Recognition of Mycobacterium leprae recombinant 18,000 MW epitopes by IgG subclasses in leprosy.

    ID: 1352991

    Description: epitope description:TSARPAVMPMDAWRE antigen name:UniProt:B8ZS71 host organism:Homo sapiens

    Publication: 7538491;

  21. Discontinuous epitopes of hepatitis B surface antigen derived from a filamentous phage peptide library.

    ID: 1350698

    Description: epitope description:RASGARARCEHRSGLSLSWQPSECSDSRTT host organism:Mus musculus antibody name:H35

    Publication: 8700874;

  22. Enhanced immunogenicity of the pre-S region of hepatitis B surface antigen.

    ID: 1350708

    Description: epitope description:MQWNSTALHQALQDPRVRGLYLPAGG antigen name:Large envelope protein host organism:Mus musculus

    Publication: 2408336;

  23. Protease-activated lymphoid cell and hepatocyte recognition site in the preS1 domain of the large woodchuck hepatitis virus envelope protein.

    ID: 1350710

    Description: epitope description:MGNNIKVTFNPDKIAAWWPAVGTYY antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 8760435;

  24. Synthetic oligopeptides bearing a common or subtypic determinant of hepatitis B surface antigen.

    ID: 1350712

    Description: epitope description:TTSTGPCKTCTTPAQ antigen name:Large envelope protein host organism:Mus musculus antibody name:Mab 5124

    Publication: 1697880;

  25. Serologic response to the Borrelia burgdorferi flagellin demonstrates an epitope common to a neuroblastoma cell line.

    ID: 1350758

    Description: epitope description:LFSGEGAQTAQAAPVQEGVQQEGAQQPAPATAPSQGGVNSPVNVT antigen name:Flagellar filament 41 kDa core protein host organism:Homo sapiens

    Publication: 7678336;

  26. Serologic response to the Borrelia burgdorferi flagellin demonstrates an epitope common to a neuroblastoma cell line.

    ID: 1350770

    Description: epitope description:QQEGAQQPAPATA antigen name:Flagellar filament 41 kDa core protein host organism:Homo sapiens

    Publication: 7678336;

  27. Serologic response to the Borrelia burgdorferi flagellin demonstrates an epitope common to a neuroblastoma cell line.

    ID: 1350771

    Description: epitope description:QPAPATAPSQGGV antigen name:Flagellar filament 41 kDa core protein host organism:Homo sapiens

    Publication: 7678336;

  28. Serologic response to the Borrelia burgdorferi flagellin demonstrates an epitope common to a neuroblastoma cell line.

    ID: 1350772

    Description: epitope description:APSQGGVNSPVNV antigen name:Flagellar filament 41 kDa core protein host organism:Homo sapiens

    Publication: 7678336;

  29. Vaccine engineering: enhancement of immunogenicity of synthetic peptide vaccines related to hepatitis in chemically defined models consisting of T- an...

    ID: 1350799

    Description: epitope description:LQDPRVRGLYFPAGG antigen name:Large envelope protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2480595;

  30. Vaccine engineering: enhancement of immunogenicity of synthetic peptide vaccines related to hepatitis in chemically defined models consisting of T- an...

    ID: 1350832

    Description: epitope description:LQDPRVRGLYFPAGG antigen name:Large envelope protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2480595;

  31. Vaccine engineering: enhancement of immunogenicity of synthetic peptide vaccines related to hepatitis in chemically defined models consisting of T- an...

    ID: 1350848

    Description: epitope description:TKPTDGN antigen name:Large envelope protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2480595;

  32. Vaccine engineering: enhancement of immunogenicity of synthetic peptide vaccines related to hepatitis in chemically defined models consisting of T- an...

    ID: 1350850

    Description: epitope description:TKPTDGN antigen name:Large envelope protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2480595;

  33. Mapping of the T and B cell epitopes of the Mycobacterium bovis protein, MPB70.

    ID: 1350935

    Description: epitope description:GTRQTLQGASVTVTGQGNSLKVGNADVVCGGVSTANATVYMIDSVLMPPA antigen name:Immunogenic protein MPB70 host organism:Mus musculus antibody name...

    Publication: 1711006;

  34. Characterization of murine B-cell epitopes on the Mycobacterium leprae proline-rich antigen by use of synthetic peptides.

    ID: 1351140

    Description: epitope description:YPPP antigen name:Proline rich antigenic protein host organism:Mus musculus BALB/c antibody name:F67-1, F67-5

    Publication: 1702765;

  35. Allelic subtypic determinants of hepatitis B surface antigen (i and t) that are distinct from d/y or w/r.

    ID: 1351142

    Description: epitope description:TIPAQGTSM antigen name:Large envelope protein host organism:Mus musculus BALB/c antibody name:I-18

    Publication: 7678309;

  36. Characterization of murine B-cell epitopes on the Mycobacterium leprae proline-rich antigen by use of synthetic peptides.

    ID: 1351149

    Description: epitope description:SYPPP antigen name:Proline rich antigenic protein host organism:Mus musculus BALB/c antibody name:F126-5

    Publication: 1702765;

  37. Allelic subtypic determinants of hepatitis B surface antigen (i and t) that are distinct from d/y or w/r.

    ID: 1351163

    Description: epitope description:TIPAQGTSM antigen name:Large envelope protein host organism:Mus musculus BALB/c antibody name:I-18

    Publication: 7678309;

  38. Cross-reactive asparagine-rich determinants shared between several blood-stage antigens of Plasmodium falciparum and the circumsporozoite protein.

    ID: 1351267

    Description: epitope description:NPNANPNANPNANPNANPNANPNA antigen name:Circumsporozoite (CS) protein host organism:Aotus trivirgatus

    Publication: 1693414;

  39. Cross-reactive asparagine-rich determinants shared between several blood-stage antigens of Plasmodium falciparum and the circumsporozoite protein.

    ID: 1351270

    Description: epitope description:NNTNNTNNTNNTNNTNNTNNTNNT host organism:Aotus trivirgatus

    Publication: 1693414;

  40. Analysis of B-cell epitopes in the variable C-terminal region of the Mycobacterium leprae 70-kilodalton heat shock protein.

    ID: 1351286

    Description: epitope description:SAPGGSNSTDDVLTRRWSTTNGSPK antigen name:Chaperone protein DnaK host organism:Homo sapiens

    Publication: 7678097;

  41. Analysis of B-cell epitopes in the variable C-terminal region of the Mycobacterium leprae 70-kilodalton heat shock protein.

    ID: 1351289

    Description: epitope description:SAPGGSNSTDDVLTRRWSTTNGSPK antigen name:Chaperone protein DnaK host organism:Oryctolagus cuniculus

    Publication: 7678097;

  42. Sera of leprosy patients with type 2 reactions recognize selective sequences in Mycobacterium leprae recombinant LSR protein.

    ID: 1351318

    Description: epitope description:IDLTNKNAAKLRGD antigen name:UniProt:B8ZU53 host organism:Homo sapiens

    Publication: 7505263;

  43. Mapping of linear B-cell epitopes of hepatitis B surface antigen.

    ID: 1351319

    Description: epitope description:RGLYFPAG antigen name:Large envelope protein host organism:Mus musculus BALB/c antibody name:5520

    Publication: 1725062;

  44. Sera of leprosy patients with type 2 reactions recognize selective sequences in Mycobacterium leprae recombinant LSR protein.

    ID: 1351320

    Description: epitope description:KNAAKLRGDLRQWVSAG antigen name:UniProt:B8ZU53 host organism:Homo sapiens

    Publication: 7505263;

  45. Sera of leprosy patients with type 2 reactions recognize selective sequences in Mycobacterium leprae recombinant LSR protein.

    ID: 1351323

    Description: epitope description:LRGDLRQWVSAGRRVG antigen name:UniProt:B8ZU53 host organism:Homo sapiens

    Publication: 7505263;

  46. Sera of leprosy patients with type 2 reactions recognize selective sequences in Mycobacterium leprae recombinant LSR protein.

    ID: 1351325

    Description: epitope description:AGRRVGGRRRGRSNSG antigen name:UniProt:B8ZU53 host organism:Homo sapiens

    Publication: 7505263;

  47. Fine-mapping of the B-cell epitope domain at the N-terminus of the preS2 region of the hepatitis B surface antigen.

    ID: 1351328

    Description: epitope description:WNSTTFHQTLQDP antigen name:Large envelope protein host organism:Mus musculus BALB/c antibody name:2-11B11, 3-11C2 and HB.OT10

    Publication: 11792393;

  48. Sera of leprosy patients with type 2 reactions recognize selective sequences in Mycobacterium leprae recombinant LSR protein.

    ID: 1351329

    Description: epitope description:GRSNSGRGRGAIDREQSA antigen name:UniProt:B8ZU53 host organism:Homo sapiens

    Publication: 7505263;

  49. Fine-mapping of the B-cell epitope domain at the N-terminus of the preS2 region of the hepatitis B surface antigen.

    ID: 1351336

    Description: epitope description:WNSTTFHQTLQDP antigen name:Large envelope protein host organism:Mus musculus BALB/c antibody name:2-11B11, 3-11C2 and HB.OT10

    Publication: 11792393;

  50. Sera of leprosy patients with type 2 reactions recognize selective sequences in Mycobacterium leprae recombinant LSR protein.

    ID: 1351340

    Description: epitope description:QSAAIREWARRNGHNV antigen name:UniProt:B8ZU53 host organism:Homo sapiens

    Publication: 7505263;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston